Dmel004022.1
Basic Information
- Insect
- Drosophila melanogaster
- Gene Symbol
- cdc5l_1
- Assembly
- GCA_000001215.4
- Location
- JANZWZ010000356.1:22149-22702[-]
Transcription Factor Domain
- TF Family
- MYB
- Domain
- Myb_DNA-binding domain
- PFAM
- PF00249
- TF Group
- Helix-turn-helix
- Description
- This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.1e-18 3.4e-15 56.2 1.8 2 46 9 54 8 54 0.97 2 2 2.6e-13 4.1e-10 39.9 0.1 1 45 60 103 60 104 0.93
Sequence Information
- Coding Sequence
- atgccgcgaataatgatcaagggcggcgtgtggcgcaacacggaggatgaaatcctcaaagctgcggttatgaaatatggcaagaaccagtggagtcgaattgcctccctcctgcacagaaagtccgccaagcagtgcaaggccaggtggtacgagtggctggatcccagcatcaagaagaccgagtggtcccgtgaggaggacgagaaactgctccacttggccaagctgatgccgacgcagtggcgcaccatagccccgatcatcggacggacggcagcccagtgcctggagcgctatgagtacttgctagaccaagcccaacgcaaagaggatggcgaggacacgatggatgatcctcgcaagttgaagcccggagagattgaccccaatccagagaccaagccggcgcggcccgatccctaa
- Protein Sequence
- MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEDEKLLHLAKLMPTQWRTIAPIIGRTAAQCLERYEYLLDQAQRKEDGEDTMDDPRKLKPGEIDPNPETKPARPDP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00915262;
- 90% Identity
- iTF_00915262;
- 80% Identity
- -