Dhel000845.1
Basic Information
- Insect
- Drosophila helvetica
- Gene Symbol
- Myrf
- Assembly
- GCA_963969585.1
- Location
- OZ018401.1:283173-283763[+]
Transcription Factor Domain
- TF Family
- NDT80_PhoG
- Domain
- NDT80_PhoG domain
- PFAM
- PF05224
- TF Group
- Unclassified Structure
- Description
- This family includes the DNA-binding region of NDT80 [2] as well as PhoG and its homologues. The family contains Swiss:Q05534 or VIB-1. VIB-1 is thought to be a regulator of conidiation in Neurospora crassa and shares a region of similarity to PHOG, a possible phosphate nonrepressible acid phosphatase in Aspergillus nidulans. It has been found that vib-1 is not the structural gene for nonrepressible acid phosphatase, but rather may regulate nonrepressible acid phosphatase activity [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.3e-08 0.00016 22.4 2.8 15 87 61 114 41 128 0.80 2 2 0.0076 94 3.6 0.1 122 134 110 122 108 139 0.81
Sequence Information
- Coding Sequence
- ATGACTCACCTAGGGCAAGCAGAACGTGGCCGACCGGAGAACTGGCACAAGTTGTTCGATCAGAGCCTTCAGGAGCTGTCCGTTATCTACTACCGCGTCGATGCGGACAAGGGTTTTAGCTTCAGCGTCTCGGACGACGCGGACGTGTGCCAGAGGAATAACCACTTTCAGGGCGGTGCCAAATTTGTGAAGACCCCGTCCCGCTTTGAGAAAATCAAATCCTTTCACTTGGATTTCCACGGCGTCAAGTTCGAGGTGCCCAACCAGACCATTTGCGTGGAGCAAAGCCAGTCGGACCGCTCCAAGAAACCATTCTATCCCGTTCCGTTCTCCGCTACGACCAACAACAATATGCGCAAGAAGGGGCGCCCCAATCCGGAGCAGCGTATGAGGTCTACATATGTGGCCGTGGGAAAATGCCGGGACCTTCCCTTTGAGCTTCTGGGCGTAAGGAAATTCAACAAGTCGATAGgtcagatccagatccagtaA
- Protein Sequence
- MTHLGQAERGRPENWHKLFDQSLQELSVIYYRVDADKGFSFSVSDDADVCQRNNHFQGGAKFVKTPSRFEKIKSFHLDFHGVKFEVPNQTICVEQSQSDRSKKPFYPVPFSATTNNNMRKKGRPNPEQRMRSTYVAVGKCRDLPFELLGVRKFNKSIGQIQIQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -