Dhel003380.1
Basic Information
- Insect
- Drosophila helvetica
- Gene Symbol
- -
- Assembly
- GCA_963969585.1
- Location
- OZ018401.1:23081403-23086133[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.3e-07 0.00013 22.3 2.1 21 60 48 87 43 91 0.87
Sequence Information
- Coding Sequence
- ATGTATACACCCCCAAAGCGCACTCGCAGCAACGCTGGGACAGCAAGTGAGCGCCTCTCTGACGCCCCTTCGCCGCAACTGCTGGAGCTGCTTAAGGTTCGTCTGACCAACCTGATTGTGTCCTTCGTCCAGGAAGCAGAGAAGCGCATCCTTATTCGAGTCACAAACTTGGAGCAAGAGGTGGTCGATCTTCGCTCTCAGAGAGATCGGCTGGATGAGCGTGTCGCACGGCTGGACCGGGAGGTGACGGACTTGCGCGCACTGAGTAGGAGCATCGAGACCAAACTGGTGGCCGACCACATGGCAACTACTGACCTTACCAGCAAGAATCCGTGA
- Protein Sequence
- MYTPPKRTRSNAGTASERLSDAPSPQLLELLKVRLTNLIVSFVQEAEKRILIRVTNLEQEVVDLRSQRDRLDERVARLDREVTDLRALSRSIETKLVADHMATTDLTSKNP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -