Dcog003996.1
Basic Information
- Insect
- Drosophila cognata
- Gene Symbol
- -
- Assembly
- GCA_035041535.1
- Location
- JAWNLC010000235.1:2078394-2078774[-]
Transcription Factor Domain
- TF Family
- MYB
- Domain
- Myb_DNA-binding domain
- PFAM
- PF00249
- TF Group
- Helix-turn-helix
- Description
- This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.3e-05 0.019 15.1 0.0 8 42 8 44 5 47 0.94 2 2 0.016 13 6.0 0.0 4 17 62 75 60 81 0.88
Sequence Information
- Coding Sequence
- atggacaaacggactaccattgaacaacggaaactcatcctggcacaccacaagaacggatattcacatcgccaaatagctgaaatggtcaatctgagcaacttaaccatgtataacatcattcggcgcttcgtcgacgcaaatcggattgagggcaaggccagaatggcaccaaacccgcttttcaccgaagaggaggatcggaggatcatcaggaaaataagggcaaatcccaagctatcaactccaaaaattactcaacaggtgcaggataaagtggggaaaaagtgctgtgtggaaactgtgcgcatggttctgcgcaaacatgacttaaatgcccgagcaccacggaaaaagtcctttataagcgcaccaaattaa
- Protein Sequence
- MDKRTTIEQRKLILAHHKNGYSHRQIAEMVNLSNLTMYNIIRRFVDANRIEGKARMAPNPLFTEEEDRRIIRKIRANPKLSTPKITQQVQDKVGKKCCVETVRMVLRKHDLNARAPRKKSFISAPN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00607011;
- 90% Identity
- iTF_00607011;
- 80% Identity
- -