Basic Information

Insect: Drosophila arizonae
Gene Symbol: sug
Assembly: GCA_001654025.1
Location: NW:3504965-3506575[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.03 1.7 8.7 2.9 1 23 127 152 121 152 0.92

2 5 6.6 3.7e+02 1.3 1.3 6 23 169 189 162 189 0.73

3 5 1.1e-07 6.4e-06 25.8 4.0 1 23 195 217 195 217 0.98

4 5 0.00055 0.031 14.2 4.1 1 23 223 247 223 247 0.99

5 5 1.3e-05 0.00073 19.3 1.5 1 23 253 279 253 279 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.03	1.7	8.7	2.9	1	23	127	152	121	152	0.92
2	5	6.6	3.7e+02	1.3	1.3	6	23	169	189	162	189	0.73
3	5	1.1e-07	6.4e-06	25.8	4.0	1	23	195	217	195	217	0.98
4	5	0.00055	0.031	14.2	4.1	1	23	223	247	223	247	0.99
5	5	1.3e-05	0.00073	19.3	1.5	1	23	253	279	253	279	0.93

Sequence Information

Coding Sequence: atgGATATCCTAGTACAAAAGCCCATCTTCTCCAATAGCGCATACTACGAGCCGCCCTCGAGTGTTGTCTATACGCCGTACAATACGCCGCCGTACATAATACAACCGGTGGCCGGCAGTTGGCTGAGTGAACAGCAATTGCCACAAATGCAATATATCCGATTCCCAACGCCGCCCATAACACCGCCAAGAGCTGCACCGTCTGCTGAagccgtttccgtttccgggtccgcttctgcttcagcttcagcttcacgCACACAGTCCGTCATCATGAAGTGCCCCAgttccggctccggctccggctctggctctggctcacccacacacacgtcCTGCAGCGATcaaagcggcagcagcagctgcagcgactgcgacttcaTATGCAATTGGCATGATTGCTCAAGAGTTTTCGAGTCCCTGGAGGCGCTCGCACAACATGTCACATTACGTCACGCCATCGCCTCGCTGCACGACGGGCTCTACTACTGCCGCTGGAGCGGTTGTCAGCGCAGCGATCGGGGCTTCAATGCGCGCTACAAGATGCTGGTCCATGTGCGCACCCATACCAAGGAGAAGCCGCACCGTTGCCATCTGTGCGAGAAGTCCTTTTCGCGTGCCGAGAACCTGAAAATACACATCCGTTCGCATTCCGGCGAGAAGCCCTACAAGTGCCACTTTGAGGGCTGCCTGAAGGCCTATTCGAATTCCTCGGATCGGTTCAagcacacgcgcacgcactcCATGGAAAAGCCCTATATGTGCAAGGTGCAGGGCTGTCAGAAACGCTACACGGATCCCTCGTCGCTGCGCAAGCATGTGAAGACGTTCAAGCACAGCATTCAGCTGATTGCCAGCCAGACGACCACCTGTATGCTGGAGGCCAGCGAGCCATCCTACACCTGCCTGAAAGCACCTGTACCTGCACCTGTAGCTGAATCCACAGCCAACTACTATCTGGATTTGGCTGAGCGTGACAACGTGGCAAGCGATTATTCGCTGCAAGCCAAACACCATAGCGAATATGCcaactcctcctcctcctcctccgccaccTCATACTGGCAGCACAATTATCGTTATCTACACAGTGAAGATATCAGCATGGATATGGATACACCAACGCCGCTCGATTTGCGCGTGCACAGAACTTGA
Protein Sequence: MDILVQKPIFSNSAYYEPPSSVVYTPYNTPPYIIQPVAGSWLSEQQLPQMQYIRFPTPPITPPRAAPSAEAVSVSGSASASASASRTQSVIMKCPSSGSGSGSGSGSPTHTSCSDQSGSSSCSDCDFICNWHDCSRVFESLEALAQHVTLRHAIASLHDGLYYCRWSGCQRSDRGFNARYKMLVHVRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCHFEGCLKAYSNSSDRFKHTRTHSMEKPYMCKVQGCQKRYTDPSSLRKHVKTFKHSIQLIASQTTTCMLEASEPSYTCLKAPVPAPVAESTANYYLDLAERDNVASDYSLQAKHHSEYANSSSSSSATSYWQHNYRYLHSEDISMDMDTPTPLDLRVHRT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00586978;
90% Identity: iTF_00554665;
80% Identity: -