Basic Information

Transcription Factor Domain

TF Family: T-box
Domain: T-box domain
PFAM: PF00907
TF Group: Unclassified Structure
Description: The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 3e-19 1.1e-15 59.3 0.2 112 167 131 185 107 186 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	3e-19	1.1e-15	59.3	0.2	112	167	131	185	107	186	0.90

Coding Sequence: ATGAGCGCGCATAAATGGGATATTTATCGGCTCGTAGCGAAAAACGCTTCGGCCTTCCTTCTGCGTCGCTCATTTTTTATCTCGTCTTTTTTAATAAGGTTCGCGCGCGCGGGCCAACATGCGAGAAATAAGGAGACGGTGACGGTGACGGGGACGGGGACGGGGACGGGGACGGGACGGAGACGAGGCATTCACGAGATCGTAAAGGACAGAAACAAAGAGAAGGAGAAAGTTTACGAGACGAATTTAGAGCGGCTTATGGAAAACTTTATTAAGTGCAATTGCCTGGGTATCGTTTGCTCTTTGTCGCTAAGCGATACGAACGGCAACATTATCCTCGTGACGAGTCCTTTTTTATTGCTCGAAATACGAATGTATTTTCAAAGTTGTAACCATCCGATGACGATATTAAATTCAATGCACAAGTATCAGCCGAGGTTTCATCTCGTCAGAGCTAATGACATCTTGAAGCTTCCTTATTCTACCTTCAGAAGTTACGTTTTCAAGGAGACTGAATTCATTGCGGTTACAGCGTACCAAAACGAAAAGGTGAGCATGCGCTTTTAA
Protein Sequence: MSAHKWDIYRLVAKNASAFLLRRSFFISSFLIRFARAGQHARNKETVTVTGTGTGTGTGRRRGIHEIVKDRNKEKEKVYETNLERLMENFIKCNCLGIVCSLSLSDTNGNIILVTSPFLLLEIRMYFQSCNHPMTILNSMHKYQPRFHLVRANDILKLPYSTFRSYVFKETEFIAVTAYQNEKVSMRF

Sequence clustering based on sequence similarity using MMseqs2