Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0064 4.4 6.9 0.7 13 41 50 75 44 76 0.86

2 7 0.027 18 4.9 2.8 11 28 76 93 74 104 0.84

3 7 0.00021 0.14 11.7 1.5 15 31 108 124 99 133 0.79

4 7 0.062 42 3.7 3.4 12 27 133 148 127 161 0.77

5 7 0.0051 3.5 7.2 0.1 18 39 167 185 153 193 0.90

6 7 0.062 42 3.7 0.8 15 26 192 203 186 216 0.75

7 7 2.2e-06 0.0015 18.0 0.5 18 44 223 246 218 246 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0064	4.4	6.9	0.7	13	41	50	75	44	76	0.86
2	7	0.027	18	4.9	2.8	11	28	76	93	74	104	0.84
3	7	0.00021	0.14	11.7	1.5	15	31	108	124	99	133	0.79
4	7	0.062	42	3.7	3.4	12	27	133	148	127	161	0.77
5	7	0.0051	3.5	7.2	0.1	18	39	167	185	153	193	0.90
6	7	0.062	42	3.7	0.8	15	26	192	203	186	216	0.75
7	7	2.2e-06	0.0015	18.0	0.5	18	44	223	246	218	246	0.96

Coding Sequence: atgtccAGGACTAGAGTATATGATGGATATactaaacataaacatattagaAGctACACAAATGATcctaaatatacaatattaagtttCGGAGCTCAGAATATAACTGAAGATAATTGTGTTGCATCAACACCAACTAAACCAAAGGCTGAAGAATCTTATAAATGTGATATTTGTGGTGaagagtttttatttaaaaaacgctTAATATCTCACATAAAGTGTCATATGAGAGAAAAAAAGTTTGAATGTAATACTTGTAATGCAAGGTTTTCACACTTGGGAAACTTAAATCTTCACATCATGATTCATACTGGtgaaaaaccatttaaatgcaatatttgtaataaatcattttcacgGAAAGGTAATTTAGAAATGCACACTAATATGCATacgaaagaaaaacaatttaaatgcaatatttgtAATATGACAATTTTACATGAAACAATCTTAAAACGTCACTATAAAACTCATACTGGATACAGACCATATAATTGTGAGTTTTGTGATAAATCATTTGCAAGGgtggataatttaaaatatcacattatGATTCATACGggacaaaatcaatttaaatgtaatatttgtgaTAAAAGTTTTCTACACCAAGGACTCTTAAAACGTCATAATATGATTCATACTGGGGTTAAACcacataaatgtaatttttgcaATTCCTCATTTTCacgtattgataattttaagacTCACTTGAAAAGGATCCATCCTGGAGAAAAAcagatgtaa
Protein Sequence: MSRTRVYDGYTKHKHIRSYTNDPKYTILSFGAQNITEDNCVASTPTKPKAEESYKCDICGEEFLFKKRLISHIKCHMREKKFECNTCNARFSHLGNLNLHIMIHTGEKPFKCNICNKSFSRKGNLEMHTNMHTKEKQFKCNICNMTILHETILKRHYKTHTGYRPYNCEFCDKSFARVDNLKYHIMIHTGQNQFKCNICDKSFLHQGLLKRHNMIHTGVKPHKCNFCNSSFSRIDNFKTHLKRIHPGEKQM

Sequence clustering based on sequence similarity using MMseqs2