Basic Information

Insect: Dione juno
Gene Symbol: zfh1
Assembly: GCA_037127375.1
Location: JAXRJS010000107.1:1549571-1557229[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 9.6 8.7e+02 1.4 0.1 7 23 2 19 2 19 0.93

2 11 3.5e-07 3.1e-05 24.8 2.1 1 23 26 48 26 48 0.98

3 11 1.5 1.4e+02 3.9 0.5 1 23 52 75 52 75 0.82

4 11 0.0085 0.76 11.0 0.5 2 23 80 102 79 102 0.95

5 11 0.0019 0.18 13.0 0.5 3 23 107 128 105 128 0.94

6 11 0.00052 0.047 14.8 1.5 1 23 131 154 131 154 0.93

7 11 0.047 4.3 8.6 2.3 2 22 163 183 162 187 0.91

8 11 0.00017 0.015 16.3 1.4 2 23 194 216 193 216 0.94

9 11 1.5 1.3e+02 3.9 1.5 1 23 222 245 222 245 0.85

10 11 3.3e-05 0.0029 18.6 1.2 3 23 256 276 255 276 0.98

11 11 8.6e-05 0.0078 17.3 0.3 1 23 282 305 282 305 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	9.6	8.7e+02	1.4	0.1	7	23	2	19	2	19	0.93
2	11	3.5e-07	3.1e-05	24.8	2.1	1	23	26	48	26	48	0.98
3	11	1.5	1.4e+02	3.9	0.5	1	23	52	75	52	75	0.82
4	11	0.0085	0.76	11.0	0.5	2	23	80	102	79	102	0.95
5	11	0.0019	0.18	13.0	0.5	3	23	107	128	105	128	0.94
6	11	0.00052	0.047	14.8	1.5	1	23	131	154	131	154	0.93
7	11	0.047	4.3	8.6	2.3	2	22	163	183	162	187	0.91
8	11	0.00017	0.015	16.3	1.4	2	23	194	216	193	216	0.94
9	11	1.5	1.3e+02	3.9	1.5	1	23	222	245	222	245	0.85
10	11	3.3e-05	0.0029	18.6	1.2	3	23	256	276	255	276	0.98
11	11	8.6e-05	0.0078	17.3	0.3	1	23	282	305	282	305	0.96

Sequence Information

Coding Sequence: ATGGataaaaCATATGCGAATGAGAAATCTTATGATCAGCATGTGCagagatttcatttaaaatcCAGCGGAAATTTCGAGTGTGACATATGCAACAAGAggtttcaatacaaatataatttaaaatctcataTAAGGGAGCATTTCACTAAATATGTGTGTACAGTGTGCGACTTCGAGGCGTACAAGCTGTGGAAGATCAAGTCACACTTGAACTTCACTCATAAGAGGGCGGTGGTGTGTTTAATATGTGGACTCAAATTTCAGAAACGTCCAGAATTCTTTCAGCATTATAAGAATATGCATACCAAAGTGATATGCGATTATTGTGGGAAGAGTTTAACGAAGAAACAAAGGCTCATTGGgcatatattTCGACGTCACAGCAGACACAGGTGTGACGTATGCAAGCGTGACTACTCGTCGCTTGACGCGCTAACACGTCACAACAATCTGAATCACGTTGTATCACGCACGGAGACGTGCTACTGTGTGGAATGTGATATACAGTTCGATAACAGCAATAGATATAGGAATCATTTGAAGACAAGTGTTAAACATAAAACTGTCGTTGGGATCCCTTGTCCGGAATGTAATAAAGTGTATAACAAACGCTACACTATGAACAACCATTACAAGCATGTACATTTGCAGAAAACAAACTTTTACTGTGAAAAATGTAGCAGGtACTTCTTAAACGGATTCCGTCTAAGACAGCACACAGCGTCTGTACACGACAAGATACCGCACgtgaagaataaaatatgcCCGCACTGTGGTAGGGGGTTCTCGACGAATAGAATATTATCAAACCATATAAAGACTCATACTGGCGAGCGGCCATTTTCCTGCGACATCTGTCAATCGACGTTTACACAGAAAACTGCGCTAGTTGTACACAAACGTGCTATACACAAagagaaataa
Protein Sequence: MDKTYANEKSYDQHVQRFHLKSSGNFECDICNKRFQYKYNLKSHIREHFTKYVCTVCDFEAYKLWKIKSHLNFTHKRAVVCLICGLKFQKRPEFFQHYKNMHTKVICDYCGKSLTKKQRLIGHIFRRHSRHRCDVCKRDYSSLDALTRHNNLNHVVSRTETCYCVECDIQFDNSNRYRNHLKTSVKHKTVVGIPCPECNKVYNKRYTMNNHYKHVHLQKTNFYCEKCSRYFLNGFRLRQHTASVHDKIPHVKNKICPHCGRGFSTNRILSNHIKTHTGERPFSCDICQSTFTQKTALVVHKRAIHKEK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -