Dlin090777.1
Basic Information
- Insect
- Dioctria linearis
- Gene Symbol
- CEBPG
- Assembly
- GCA_963930735.1
- Location
- OZ005743.1:192413180-192413555[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 6.4e-09 3.4e-05 26.4 12.0 2 57 14 69 13 76 0.92 2 2 1.1 5.9e+03 -0.0 0.1 22 37 75 90 74 93 0.85
Sequence Information
- Coding Sequence
- ATGTCACCAAGAAAGCGAAATCCTAGTAGCTCACCAGATGAAGATGACTACAGAAAAAAACGGGAAAGAAATAATTTGGCCGTGAAAAAATGTAGAATTAAATCTAACGAGCAAGCTAAGAAGATAAAGGCTCAAACAGaggagttgaaaacaaaaaataaaattctaaaaggCAGAATACAAGAGACAGAGGAAAACATTCAAAGTGCTATTTCATTGATAAGAAAGAAGGATTCGTCAGAAGAAGTAGAagctaaaattaaagaaattatggAGTCTGGTAGAGGAACAACAGAAGAATATGATTAA
- Protein Sequence
- MSPRKRNPSSSPDEDDYRKKRERNNLAVKKCRIKSNEQAKKIKAQTEELKTKNKILKGRIQETEENIQSAISLIRKKDSSEEVEAKIKEIMESGRGTTEEYD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -