Basic Information

Insect: Diaprepes abbreviatus
Gene Symbol: -
Assembly: GCA_034092305.1
Location: JASJET010000118.1:1063983-1064732[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 6.6e-06 0.00094 21.2 1.7 1 23 13 36 13 36 0.97

2 8 0.00034 0.048 15.8 0.7 1 23 41 64 41 64 0.97

3 8 3.1e-06 0.00044 22.2 2.2 1 23 73 96 73 96 0.97

4 8 0.062 8.8 8.7 2.2 2 23 106 129 105 129 0.90

5 8 1.9e-05 0.0026 19.7 0.6 1 23 136 158 136 158 0.99

6 8 0.00022 0.031 16.4 4.5 1 23 165 187 165 187 0.99

7 8 0.00048 0.068 15.3 0.2 1 23 193 215 193 215 0.93

8 8 0.00011 0.016 17.3 1.5 1 23 221 244 221 244 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	6.6e-06	0.00094	21.2	1.7	1	23	13	36	13	36	0.97
2	8	0.00034	0.048	15.8	0.7	1	23	41	64	41	64	0.97
3	8	3.1e-06	0.00044	22.2	2.2	1	23	73	96	73	96	0.97
4	8	0.062	8.8	8.7	2.2	2	23	106	129	105	129	0.90
5	8	1.9e-05	0.0026	19.7	0.6	1	23	136	158	136	158	0.99
6	8	0.00022	0.031	16.4	4.5	1	23	165	187	165	187	0.99
7	8	0.00048	0.068	15.3	0.2	1	23	193	215	193	215	0.93
8	8	0.00011	0.016	17.3	1.5	1	23	221	244	221	244	0.95

Sequence Information

Coding Sequence: ATGAATTACCATCAACGAACTCACAAAGAAAAGCGATATCAGTGCGAAATATGCGGAAAAAACTTTAGAGAACAATGTACACTAGCATACCATCTTAGAAATATTCATGAAAAAGTACGATATCCTTGTGAAGTTTGTAAAAAAGATTTATCCTCCCAACAAAGCTATGAGAGACACAAATTGACCATGCACGAAAAAGAAAAACGTATCCTAAAATATTCGTGCGAAAAATGTGGGAAAAATTTTATGTATCAAAGTCAGCTCGCACATCATTTAAAAAATGGACACATTGAAGAAAAAGTTACCGATTTTATTAAATGTACGTATCTTGGATGTTCAAAAGTTTTCAAATGTTCTTCTTCGTTACGGTACCATCTACCTACCCACGAAGAAAATAAACCGACTTATCAATGCCCCATTTGTTCCAAAATTTTAGGTCATCCTATCTCGTTAAAACGGCACAAAAGGATCCATGAAGATGAACCTAAAATGTACTCCTGTCATATCTGCGATAAAAAAGTTACTTCAGCTCAAAGTTTGAAGTGTCATATACGAACTCACACTGGCGAGAAACCATTTGTTTGTGAGTCTTGTGGGAAGGAATTTAACAAACTTACCCTTCTGCGAATACATAGTGTAGTACATACTAAAGAGAGAAAGCATGTTTGTAAGGTCTGTCAAAAGGCTTTTACTCAAAGAGGACCTCTTAGGGTCCATTTTTTAAAGAATCACCCGCTGGACAAATTATAG
Protein Sequence: MNYHQRTHKEKRYQCEICGKNFREQCTLAYHLRNIHEKVRYPCEVCKKDLSSQQSYERHKLTMHEKEKRILKYSCEKCGKNFMYQSQLAHHLKNGHIEEKVTDFIKCTYLGCSKVFKCSSSLRYHLPTHEENKPTYQCPICSKILGHPISLKRHKRIHEDEPKMYSCHICDKKVTSAQSLKCHIRTHTGEKPFVCESCGKEFNKLTLLRIHSVVHTKERKHVCKVCQKAFTQRGPLRVHFLKNHPLDKL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -