Basic Information

Insect: Culicoides brevitarsis
Gene Symbol: -
Assembly: GCA_036172545.2
Location: CM070086.1:30701720-30702577[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 3.9e-07 1.5e-05 25.0 0.6 3 23 7 27 5 27 0.97

2 9 1.5e-05 0.00056 20.0 2.6 2 23 65 86 65 86 0.98

3 9 0.014 0.53 10.7 2.0 1 23 91 114 91 114 0.90

4 9 0.29 11 6.5 1.4 2 23 122 143 121 143 0.92

5 9 0.012 0.47 10.8 0.4 1 23 149 172 149 172 0.94

6 9 2.3e-05 0.00088 19.4 0.6 1 23 178 201 178 201 0.96

7 9 8.3e-06 0.00032 20.8 0.8 2 23 208 229 208 229 0.98

8 9 0.001 0.038 14.3 0.4 1 23 234 259 234 259 0.96

9 9 0.00052 0.02 15.1 1.7 1 23 262 285 262 285 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	3.9e-07	1.5e-05	25.0	0.6	3	23	7	27	5	27	0.97
2	9	1.5e-05	0.00056	20.0	2.6	2	23	65	86	65	86	0.98
3	9	0.014	0.53	10.7	2.0	1	23	91	114	91	114	0.90
4	9	0.29	11	6.5	1.4	2	23	122	143	121	143	0.92
5	9	0.012	0.47	10.8	0.4	1	23	149	172	149	172	0.94
6	9	2.3e-05	0.00088	19.4	0.6	1	23	178	201	178	201	0.96
7	9	8.3e-06	0.00032	20.8	0.8	2	23	208	229	208	229	0.98
8	9	0.001	0.038	14.3	0.4	1	23	234	259	234	259	0.96
9	9	0.00052	0.02	15.1	1.7	1	23	262	285	262	285	0.95

Sequence Information

Coding Sequence: atgccgaGAAAAACGTTTTGTGACATTTGCAATCGTTCTTTCACAAAGAAAAGCAGCTTAGAGGCGCACATGGAAATTCATTTGAGCGATCTCATCAAAGATTATCCAGACAGTCAAAAATGCAAACACTGCCCGAGATTCATCTTAAAAGAAAACATGCGAAAACACTGTTTAGAGCATCACAAAATGCGAAAATGTGAAGAGTGTGGAAAATGTTTCTACAATAAAGAACCATATtacaaacacataaaaatgcaCAAAGAACCGAGATTTTTCTGTGACCTTTGTGGATTTAAAGCTTTTGTTAAAAGAAGTTTAGAGAGACACATGAACCACATTCAtcttaaaaacatcaaaaagtcaaaatgtgaaatttgtaaaaaatatatttcaatccATTGGATGAAATCTCACATCCGGActgttcatgaaaaaattttcagacatTCGTGTGTCGTTTGTAAAGTTGGATTTCAAACTGCAACGACACTACGAGATCATCTAGCAATCAAACATTTGGGACAAGAACCTCACAAATGCAAAATTTGTGGAATAAGCGTTTTTAGTAAAAGTTCCTTGAATGAACACATTAAAGCGGTGCATGAGAAAGTTATTGCCGCTACAtgtaaaaaatgtggaaaaacgTTTGGATACAGAGCTGGGTACAATGCTCATTTGAAAACGCACGAAAAGAAGCCATTTAGTTGCACTGTCGACAAATGTCCTCAAAGGTATGCGACAGAAAAGGGTTTGAAGAAACATCTTTCAAGACCTCACCAAAAGTTTGATTGTGATCAGTGTGAAAAATCTTACGACCGAAAAGGAAGTTTGGATaaccataaaaaatacaaacattgA
Protein Sequence: MPRKTFCDICNRSFTKKSSLEAHMEIHLSDLIKDYPDSQKCKHCPRFILKENMRKHCLEHHKMRKCEECGKCFYNKEPYYKHIKMHKEPRFFCDLCGFKAFVKRSLERHMNHIHLKNIKKSKCEICKKYISIHWMKSHIRTVHEKIFRHSCVVCKVGFQTATTLRDHLAIKHLGQEPHKCKICGISVFSKSSLNEHIKAVHEKVIAATCKKCGKTFGYRAGYNAHLKTHEKKPFSCTVDKCPQRYATEKGLKKHLSRPHQKFDCDQCEKSYDRKGSLDNHKKYKH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -