Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 2.4 3.1e+03 -1.9 0.8 19 25 53 59 44 61 0.77

2 7 0.31 3.9e+02 1.0 0.0 16 26 98 108 89 110 0.82

3 7 0.16 2e+02 1.9 6.8 13 43 158 185 152 186 0.81

4 7 0.0016 2.1 8.2 0.3 15 44 188 214 183 214 0.89

5 7 4.1e-08 5.3e-05 23.0 4.9 4 44 234 271 231 271 0.95

6 7 0.048 61 3.5 0.2 18 39 278 296 272 300 0.76

7 7 0.011 14 5.6 2.3 19 44 307 329 304 329 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	2.4	3.1e+03	-1.9	0.8	19	25	53	59	44	61	0.77
2	7	0.31	3.9e+02	1.0	0.0	16	26	98	108	89	110	0.82
3	7	0.16	2e+02	1.9	6.8	13	43	158	185	152	186	0.81
4	7	0.0016	2.1	8.2	0.3	15	44	188	214	183	214	0.89
5	7	4.1e-08	5.3e-05	23.0	4.9	4	44	234	271	231	271	0.95
6	7	0.048	61	3.5	0.2	18	39	278	296	272	300	0.76
7	7	0.011	14	5.6	2.3	19	44	307	329	304	329	0.89

Coding Sequence: ATGGAAATGAAAAACAGCAGAGTGGAAAACGGAGTCGCCGATGTCAGTCAAGTGTCGCACTTATTGGCCAAAAaccaaaacaataacaaaccctttgagaaattttccatcaaaattggGAACCGGAGCTTTTGTGGCAAGAAAATGGAATTAATGTGCAGATTATGTctgaaaatacaaacaaaattcgatttaattgagatttttggtgaaaatgGAAGATTAAAACAGTTGtcattgaagatttttgacgtttttcgtgttgaaataattgaaaatttggaccTTCCAACAGCTATTTGTCTCTTCTGCTACAACAAATTGGAGGATTTTTGGACGTTTTCAAGGATTGTTTTGGATAACCAACAAAAGTTAGAGCAACTTTCATCCCCCAAAATACCGGAAAATGCTGAAATTCCTTTAGATGACGTCAATAATTGCTCTTCAGATGAAAACGAAGAAGATATCATccacaaaaatcgctttattTGCCATCATTGCTCCAAAAGTTTCACCAAAAAAGTCACTTTACTCCATCATATCAACGCTTCTCATCTAAATACGAGATTTTCTTGTCCTAAATGCCCAAAAACGTACAAATACAGGAGCGATTTGCGTTTTCACCTGAAATCTGATCATTCAAATCACAAAAGACTGAAAGAAAAATGTCCTCAATGCGGGATTTCCGTTTTCGATATGAAAGCCCATCTTCAAAGACATGAAGAACGAAGCCTGAATTTAACTTGCAACATctgtgataaaaatatttccaacaaaaaatgtcttgaaattcACATGAAACGAATGCATTCGGAAATTAAAAGACTTTTCGAGTGTCCAACGTGCGAAAAAtcgttttcatcaaaaatttctttgaaaaatcacCTCGCTACTCATTCTGGAGTCTTTTTGTATCATTGTGActtttgcgagaaaaaattCCGGAACACAGGAAACAAATCGCGACACATAAAAaacgttcataaaaaaataaattaa
Protein Sequence: MEMKNSRVENGVADVSQVSHLLAKNQNNNKPFEKFSIKIGNRSFCGKKMELMCRLCLKIQTKFDLIEIFGENGRLKQLSLKIFDVFRVEIIENLDLPTAICLFCYNKLEDFWTFSRIVLDNQQKLEQLSSPKIPENAEIPLDDVNNCSSDENEEDIIHKNRFICHHCSKSFTKKVTLLHHINASHLNTRFSCPKCPKTYKYRSDLRFHLKSDHSNHKRLKEKCPQCGISVFDMKAHLQRHEERSLNLTCNICDKNISNKKCLEIHMKRMHSEIKRLFECPTCEKSFSSKISLKNHLATHSGVFLYHCDFCEKKFRNTGNKSRHIKNVHKKIN

Sequence clustering based on sequence similarity using MMseqs2