Cpip003904.1
Basic Information
- Insect
- Culex pipiens
- Gene Symbol
- -
- Assembly
- GCA_016801865.2
- Location
- NC:117135294-117136753[-]
Transcription Factor Domain
- TF Family
- ARID
- Domain
- ARID domain
- PFAM
- PF01388
- TF Group
- Helix-turn-helix
- Description
- This domain is know as ARID for AT-Rich Interaction Domain [2], and also known as the BRIGHT domain [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2e-07 0.00015 22.6 0.0 27 88 2 61 1 62 0.89
Sequence Information
- Coding Sequence
- atgggaggtaggaatgtggattcgcaccggttgtattgggtggtggtggcccgggattggtgGTTGAAGGTCAATTCGAGTGAGGACTGGGgcgagatcatcgaggagatggcgctgccgaagcgttgcgtgaacaacgagattgcgttgaagaagattaacttccggtttttggacaagtacgcgaatgtttattttcacgaAGGGCCTCCGACGAAGAGGAGGAAGACGAAAAGCTACATAATCGGAGGTGCTCAGCGCAGATGTTGCACttggtgccggcggtttacagcACCGcaacttcccgcccacaaacactcacgtcgcgacggcgcagcttcagcCGAATGA
- Protein Sequence
- MGGRNVDSHRLYWVVVARDWWLKVNSSEDWGEIIEEMALPKRCVNNEIALKKINFRFLDKYANVYFHEGPPTKRRKTKSYIIGGAQRRCCTWCRRFTAPQLPAHKHSRRDGAASAE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00400346;
- 90% Identity
- iTF_00400346;
- 80% Identity
- -