Cpip003006.1
Basic Information
- Insect
- Culex pipiens
- Gene Symbol
- -
- Assembly
- GCA_016801865.2
- Location
- NC:87516560-87517442[+]
Transcription Factor Domain
- TF Family
- ARID
- Domain
- ARID domain
- PFAM
- PF01388
- TF Group
- Helix-turn-helix
- Description
- This domain is know as ARID for AT-Rich Interaction Domain [2], and also known as the BRIGHT domain [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.1e-07 0.00016 22.5 0.0 25 89 30 92 17 92 0.88
Sequence Information
- Coding Sequence
- ATGTCTGCAGGAcctgcagctgtttcacgaccgGAATGGGttagaaggaagcttgggtgttttgtgattgattttgattgtttttgtaggatgggaggtaggaatgtggatacgaaccggttgtattcggtgaTGGTGACCCGGGGATGGTGGTTGAAGGTCGATTCCCGCGAGGACTGGGacgagatcatcgaggagatggcgctgccgaCGCGTTGCGTGAACAAGAAGATTGCGTTGAAGAAAAATAACATCCGatttttggacaagtacgagaaaggatccgacgaagaggaggacggCAAGAAGCggcataatcggaggtggtcagcgcggatgttgcactcgatGTCGGCGGTTCAcaacaccgcaacttcCCGCCCACAAACGCTCAcatcgcgacggcgcagcttcagcTGGGGACAGCGAGCATGA
- Protein Sequence
- MSAGPAAVSRPEWVRRKLGCFVIDFDCFCRMGGRNVDTNRLYSVMVTRGWWLKVDSREDWDEIIEEMALPTRCVNKKIALKKNNIRFLDKYEKGSDEEEDGKKRHNRRWSARMLHSMSAVHNTATSRPQTLTSRRRSFSWGQRA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -