Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 1.5 1.4e+03 -0.4 0.1 12 25 34 47 18 50 0.64

2 9 0.0003 0.28 11.4 0.3 17 39 102 121 96 126 0.88

3 9 7.6e-05 0.071 13.3 4.2 19 41 132 151 122 153 0.90

4 9 0.63 5.8e+02 0.8 0.5 18 36 159 174 154 181 0.75

5 9 0.57 5.3e+02 0.9 0.4 17 40 186 206 171 208 0.79

6 9 0.0026 2.5 8.4 0.2 1 40 199 234 199 237 0.85

7 9 0.018 17 5.7 1.5 14 40 239 262 232 268 0.82

8 9 0.44 4.1e+02 1.3 4.3 18 41 271 291 266 293 0.88

9 9 6.5e-05 0.061 13.5 1.5 17 41 298 319 291 321 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	1.5	1.4e+03	-0.4	0.1	12	25	34	47	18	50	0.64
2	9	0.0003	0.28	11.4	0.3	17	39	102	121	96	126	0.88
3	9	7.6e-05	0.071	13.3	4.2	19	41	132	151	122	153	0.90
4	9	0.63	5.8e+02	0.8	0.5	18	36	159	174	154	181	0.75
5	9	0.57	5.3e+02	0.9	0.4	17	40	186	206	171	208	0.79
6	9	0.0026	2.5	8.4	0.2	1	40	199	234	199	237	0.85
7	9	0.018	17	5.7	1.5	14	40	239	262	232	268	0.82
8	9	0.44	4.1e+02	1.3	4.3	18	41	271	291	266	293	0.88
9	9	6.5e-05	0.061	13.5	1.5	17	41	298	319	291	321	0.88

Coding Sequence: ATGGGTACTTGCAATTGGTGCTTGCGAGCGGTCCCGGTGCAGACCATCGAAAAGAAGTTGTGGCGTTTCTGGATAGTAATCAGCGATGAAGATCCACCCGAAGCGTCCCTGAGGAATATCTGCGCGAAATGTAAGTCGCGCTACGAGGACTTCTCGGTGTACGTCGAGAGGTGCAAAGCCCACGCGTCCGTGATAGAGGGGATACGGTCCGGTGGGCACGTCAAGCGCGAGCTCCCGATCGACGTCGAGTATCATCCCGTGGTCAAGGAAGAAGTCGACGGCGGTTCCACGATTCCGGCTAATCTCACGTGTTCCTATTGCGATAAGACTTTCGATTACTCGTCCCGGTTGAAGACTCACATGAGCATCCATTCGAGTGACAAACCGTTCGGGTGTTCGTTGTGCGGTAAGGCTTACAAGAGGACGTGCAATTTGAAGCGTCACTTACGTACTCATACAGGCGACAAGCCGTTCGAATGCTCACGGTGCAAGAAGACCTTCACCGACTCGTTTGCCCTCAAGAGGCACTGGCGCGTTCACACCGGCGGTAAACCCTTCAAGTGTCCGTCCTGCGATAAGGCTTTCACTTGGTCGAGTGCTTTGAAGAGCCACGTGCGCCTCCATACCGGCGAGAAGCCTTTCGAATGTTCGCTCTGCGATAAGGCCTTTAATCTCTCCAGTACTTTAACagggcacatgcgccttcacacgggcgagaagcccTTCACGTGTTCGCACTGCGATAAGTCTTTTACTCTGGCTAGTACTTTGAGCGCtcacatgcgccttcacacCGGCCGTAGGCCTTTCACGTGTTCATtctgtagtaagacttttactcagtgtAGTCACTTGAGGATTCACTTGCGCAGTCATACGGGCGAAAAGCCGTTCGAGTGTTCGGTATGTGATATGACTTTCACTCGGTCTACTAACTTGAAGAGGCACTTGCGCCGACACGCAGTAAAAGACACTGCTCATGCGCAGTGA
Protein Sequence: MGTCNWCLRAVPVQTIEKKLWRFWIVISDEDPPEASLRNICAKCKSRYEDFSVYVERCKAHASVIEGIRSGGHVKRELPIDVEYHPVVKEEVDGGSTIPANLTCSYCDKTFDYSSRLKTHMSIHSSDKPFGCSLCGKAYKRTCNLKRHLRTHTGDKPFECSRCKKTFTDSFALKRHWRVHTGGKPFKCPSCDKAFTWSSALKSHVRLHTGEKPFECSLCDKAFNLSSTLTGHMRLHTGEKPFTCSHCDKSFTLASTLSAHMRLHTGRRPFTCSFCSKTFTQCSHLRIHLRSHTGEKPFECSVCDMTFTRSTNLKRHLRRHAVKDTAHAQ

Sequence clustering based on sequence similarity using MMseqs2