Cdil010248.1
Basic Information
- Insect
- Creontiades dilutus
- Gene Symbol
- ewg_3
- Assembly
- GCA_031894815.1
- Location
- JAVIWC010001252.1:138985-143656[+]
Transcription Factor Domain
- TF Family
- Nrf1
- Domain
- Nrf1_DNA-bind domain
- PFAM
- PF10491
- TF Group
- Basic Domians group
- Description
- In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human [1]. Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila [2]. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Swiss-Prot:Q8C4C0 there is also an NLS domain at 88-116, and a DNA binding and dimerisation domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.3e-75 1.5e-71 241.8 0.0 17 211 9 202 3 204 0.94
Sequence Information
- Coding Sequence
- ATGTTAATACAAATTTTGCATTTCCGCAGGGTTTGTTACCAGTTCGAGCCAGACCCGACCGTCCGCAAGAGACACTGCAATAAGCTTCTTCGCCGACTGAAGATGATTTTGGACGAATTCAGCGTTCGCATCGGCCAGCAGATTGCGATAATTGTCGCTCATCCTCCCACGTCGAGCGTGCGAACGATCAAAACCTTCGGTTCAGAGCCATTGCAGAAGGTTATCACTCGTTACCATCCAACAATTGTTACTGATTTATCTGAAGCATTGGCCAGTCAAGAAGATCGTATGCCAGCAGATCCTACTCGCTTCGAGCTGCCGCCTCTGATCACAGAGGGGAAACCCACTCCAGTTGAAAAGATGACGCAAGCGCAGTTGAGAGAATTCATTCCCATCATGCTCCGTTACTCGACGGGCCGAGGAAAACCTGGTTGGGGGAAAGAACGTATGCGCCCTCCATGGTGGCCCGAGGACATCCCCTGGTCCAACATTCGACTTGATTCGCGAGACTTTGAAAGCAAGTCAATGGAATCCTGGTCCTCTACACTTCGAAGGATCATAGTCGCTTGCTACAGATACCATGGCAGAGATGACCTTCTCGACGAGGCAGCCATCAAATGCGGTTATTCCCGTTCATCGCTGGATGTTCTGTCTATGAACGaatctgaagagaaaaaatcgaCTGGAGCAGCTGGATCCTTCACTCTCCCCGGGCAGGCTCCGTTCGAGAAGATCGTCCACGAAGATGGCACCATCTCCTTATACGTCCCGAAACCCTCTGACACTCGCCACGTCATCCTCACAGACGCGGACGGGCAGGAGTATTGCGTCGAGATTTCAGTTCCCAACTCGACATCAGCTGTTTTAGCTAACTTCCAAATGACCGCCACTGAGGCGCCTCTCCAACAAATGGCCGTGACCCCAAGCCATGTCGTAAGTCTCAGTAACTAA
- Protein Sequence
- MLIQILHFRRVCYQFEPDPTVRKRHCNKLLRRLKMILDEFSVRIGQQIAIIVAHPPTSSVRTIKTFGSEPLQKVITRYHPTIVTDLSEALASQEDRMPADPTRFELPPLITEGKPTPVEKMTQAQLREFIPIMLRYSTGRGKPGWGKERMRPPWWPEDIPWSNIRLDSRDFESKSMESWSSTLRRIIVACYRYHGRDDLLDEAAIKCGYSRSSLDVLSMNESEEKKSTGAAGSFTLPGQAPFEKIVHEDGTISLYVPKPSDTRHVILTDADGQEYCVEISVPNSTSAVLANFQMTATEAPLQQMAVTPSHVVSLSN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -