Basic Information

Transcription Factor Domain

TF Family: HSF
Domain: HSF_DNA-bind domain
PFAM: PF00447
TF Group: Helix-turn-helix
Description: Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 3.5e-29 6e-25 87.6 0.2 1 100 12 114 12 114 0.92

2 2 0.2 3.4e+03 -1.4 0.0 75 93 160 178 130 184 0.65

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	3.5e-29	6e-25	87.6	0.2	1	100	12	114	12	114	0.92
2	2	0.2	3.4e+03	-1.4	0.0	75	93	160	178	130	184	0.65

Coding Sequence: ATGTACGAATATAATATTTTGTTGTCAACAAGATTTCCGCAAAAGTTATGGAAAATAATAAACGAATGTCAAACGGGTTCAATACGATGGAGTTTAAATGGTACGACAATTTTATTAGATTATAAAAAGTTTCGTGAAGAATATTTGAGCCCACCGCAATCAATTTTCAAAACTAATAATATCTCGAGCTTTATACGTCAATTAAATCTTTACGGCTTTCGAAAAGTGACATCACATAATCGTGATCCATCATGTAATTCACGTAATCCTGATATTCATGAATTTTTGCACGATAATTTTAATCGTAGTCGTGCAGATCTTTTGAGTAAAGTATGTCGTAAAACTTCGGGGAAATTAAATAAACGCAATGAACGAGCTGAAGCTAAAAATTTTCCACGGAATGACGTAATCAATAAATCAAGAGCGCAAGGAATTTCCCGATTACAAATGTGCCAGCTTGCTCTTAAAAAAGCGTTGGAACAAGCGGTTGCTGATTATCGACGCAAGAAATTTGAAGAATTGAAAAAAATTGTACTCACAAATCATCAAGATCGATTGTGA
Protein Sequence: MYEYNILLSTRFPQKLWKIINECQTGSIRWSLNGTTILLDYKKFREEYLSPPQSIFKTNNISSFIRQLNLYGFRKVTSHNRDPSCNSRNPDIHEFLHDNFNRSRADLLSKVCRKTSGKLNKRNERAEAKNFPRNDVINKSRAQGISRLQMCQLALKKALEQAVADYRRKKFEELKKIVLTNHQDRL

Sequence clustering based on sequence similarity using MMseqs2