Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.016 31 4.1 0.1 17 25 16 24 11 27 0.84

2 11 0.00097 1.9 8.0 2.7 5 38 33 62 29 67 0.87

3 11 6.8e-05 0.13 11.7 2.0 1 39 57 92 57 99 0.89

4 11 4.2e-05 0.08 12.4 1.9 18 40 102 121 90 124 0.87

5 11 0.0038 7.4 6.1 1.5 17 36 129 150 121 151 0.77

6 11 0.0001 0.2 11.1 4.0 2 40 143 178 142 184 0.87

7 11 0.0026 4.9 6.6 1.8 17 38 186 204 172 209 0.78

8 11 0.01 19 4.7 3.1 5 38 203 232 199 236 0.71

9 11 6.6e-05 0.13 11.7 4.2 5 37 231 260 227 266 0.80

10 11 6.4e-05 0.12 11.8 1.0 16 40 270 291 256 294 0.81

11 11 0.0096 18 4.8 4.4 6 36 289 320 288 326 0.70

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.016	31	4.1	0.1	17	25	16	24	11	27	0.84
2	11	0.00097	1.9	8.0	2.7	5	38	33	62	29	67	0.87
3	11	6.8e-05	0.13	11.7	2.0	1	39	57	92	57	99	0.89
4	11	4.2e-05	0.08	12.4	1.9	18	40	102	121	90	124	0.87
5	11	0.0038	7.4	6.1	1.5	17	36	129	150	121	151	0.77
6	11	0.0001	0.2	11.1	4.0	2	40	143	178	142	184	0.87
7	11	0.0026	4.9	6.6	1.8	17	38	186	204	172	209	0.78
8	11	0.01	19	4.7	3.1	5	38	203	232	199	236	0.71
9	11	6.6e-05	0.13	11.7	4.2	5	37	231	260	227	266	0.80
10	11	6.4e-05	0.12	11.8	1.0	16	40	270	291	256	294	0.81
11	11	0.0096	18	4.8	4.4	6	36	289	320	288	326	0.70

Coding Sequence: ATGTTGACACCTACAATGAAAGTGAATAAGCCCAAAGTGCGTCGCTTTACGTGCAATTATTGCgtcaaatcattttttagtgTATGTGAATTGAATAAGCATATCCGCATCCATACAGGCGAAAAACTGTATAAATGTGAAGTTTGCAATAAATCTTTTACTCAAAAATCTAATCTAAAATCACATGCTCTAGTCCATAATAAGAAAGATCGGTACTTTCAATGCAACTATTGCCGTAAGAGTTTTCCTCAAACAAAAGAACTTGTAAAACACATTGGCATCCATACAGGCGAAAGGCCATTTTCATGCCAAATTTGTGGCAAAACTTTTACTCAAACCTCTAATCTAAACAAGCACATTCGCATCCATACAGGCGAAAAACCGTTTAATTGTGAAATTTGCGGCAAATCTTTCAATCAATCGTCTCATCTAAAATCGCATACTCTAATCCATAATAAGAAAGATCGGTACTTTCAATGCGACTATTGCCGTaagaatttttctcaaaaaaaagaacttgtaaAGCACATTCGCATCCATACAGGCGAAAGGCCATTTTCATGCCAAATTTGTGGCAAAACTTTTACTCAAACCGCTAATCTAAACAAGCATACTCACATCCATACAGGCAAAAAACCGTTTAATTGTGAAATTTGCGGCAAATCTTTCAATCAATCGTCTCATCTAAGATCGCATACTTTACTCCATAGTAAGAAAGATCGGTACTTTCAATGCAACTATTGCCGTAAGAACTTTTCTCAAAAACAAGAACTTGTAAAGCACATTCGCATCCATACAGGCGAAAGGCCATTTTCATGCCAAATTTGTGGCAAAACTTTTAGTCAAACTGCTAATCTAAACAAGCATATTCGCATCCATACAGGCGAAAAACCGTTTAATTGTGAAATTTGCGGCAAATCTTTCAATCAATCGTCTCATCTAAAATCGCATACTCTAATTCATAACAAGAAACATCGGTACTTTTAA
Protein Sequence: MLTPTMKVNKPKVRRFTCNYCVKSFFSVCELNKHIRIHTGEKLYKCEVCNKSFTQKSNLKSHALVHNKKDRYFQCNYCRKSFPQTKELVKHIGIHTGERPFSCQICGKTFTQTSNLNKHIRIHTGEKPFNCEICGKSFNQSSHLKSHTLIHNKKDRYFQCDYCRKNFSQKKELVKHIRIHTGERPFSCQICGKTFTQTANLNKHTHIHTGKKPFNCEICGKSFNQSSHLRSHTLLHSKKDRYFQCNYCRKNFSQKQELVKHIRIHTGERPFSCQICGKTFSQTANLNKHIRIHTGEKPFNCEICGKSFNQSSHLKSHTLIHNKKHRYF

Sequence clustering based on sequence similarity using MMseqs2