Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.65 5.3e+03 -1.6 1.6 15 19 9 13 8 13 0.82

2 8 0.021 1.7e+02 3.2 2.5 4 11 42 49 41 50 0.92

3 8 1.6e-07 0.0013 19.5 15.1 1 19 54 71 54 71 0.94

4 8 0.33 2.7e+03 -0.7 1.2 6 10 97 101 96 101 0.90

5 8 1.3e-07 0.001 19.8 14.1 1 19 107 125 107 125 0.97

6 8 3.1 2.5e+04 -3.7 3.9 7 13 129 135 129 136 0.75

7 8 4 3.2e+04 -4.4 3.2 6 10 155 159 154 160 0.60

8 8 4.1e-10 3.3e-06 27.8 14.8 1 19 165 183 165 183 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.65	5.3e+03	-1.6	1.6	15	19	9	13	8	13	0.82
2	8	0.021	1.7e+02	3.2	2.5	4	11	42	49	41	50	0.92
3	8	1.6e-07	0.0013	19.5	15.1	1	19	54	71	54	71	0.94
4	8	0.33	2.7e+03	-0.7	1.2	6	10	97	101	96	101	0.90
5	8	1.3e-07	0.001	19.8	14.1	1	19	107	125	107	125	0.97
6	8	3.1	2.5e+04	-3.7	3.9	7	13	129	135	129	136	0.75
7	8	4	3.2e+04	-4.4	3.2	6	10	155	159	154	160	0.60
8	8	4.1e-10	3.3e-06	27.8	14.8	1	19	165	183	165	183	0.98

Coding Sequence: TCCAAATCAGAATCCGGCTGGCGGTGCCCAGCCTGCCAGAATGTACTCCTAGACCTACCTCGCGAGTATTTCTGCTTTTGTGGCAAGCAGAAGAATCCATCGGTGACCAGAACAGAGTTGCCTCACAGCTGTGGCGAGGTTTGCTGCCGTATCGAGGGCTGCAGTCATGCCTGCACCTTGCTCTGCCATCCCGGGCCTTGTCCTCCCTGTCAGGCCAATGTTCAGCGCAGCTGCGGCTGTGGACGCACCAACCGTACCATGCAGTGCGCCATGAAGCCCGACTTGCAGTGCGAGGCGGTTTGCGATAAGGTGCTCAACTGCGGCGAGCATCGGTGTGTGGAAAAGTGTCATACGGGCAAGTGTGGCGCCTGCCAGGAACAGTTGGAACAACATTGTCACTGTGGCAAGCAGGAGCGTCAGGTGCAGTGTACCCGCGAGAGCCAGGACAAGCGCACGTATTCGTGCAAGGAATGCTGTGGCAAAGCCTTGCCCTGTGGCAATCACAAGTGCAAGGATTCGTGCCATGCCGGTCCCTGTCGGCCCTGCAAGCTCAGCCCTTCGCAGATCACCAGCTGCCCCTGCGGTAAAGTGGCCGTGCTCG
Protein Sequence: SKSESGWRCPACQNVLLDLPREYFCFCGKQKNPSVTRTELPHSCGEVCCRIEGCSHACTLLCHPGPCPPCQANVQRSCGCGRTNRTMQCAMKPDLQCEAVCDKVLNCGEHRCVEKCHTGKCGACQEQLEQHCHCGKQERQVQCTRESQDKRTYSCKECCGKALPCGNHKCKDSCHAGPCRPCKLSPSQITSCPCGKVAVL

Sequence clustering based on sequence similarity using MMseqs2