Cbeh008847.1
Basic Information
- Insect
- Colias behrii
- Gene Symbol
- sd_1
- Assembly
- GCA_029959075.1
- Location
- JARWMB010000007.1:10554565-10560132[-]
Transcription Factor Domain
- TF Family
- TEA
- Domain
- TEA domain
- PFAM
- PF01285
- TF Group
- Helix-turn-helix
- Description
- The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.3e-11 7.5e-07 30.3 0.0 2 36 63 99 62 102 0.89
Sequence Information
- Coding Sequence
- ATGAAATCAAAAAAGCGACAGGAGATGATGATGAcGAGCGGCGCGCTCGCGGCCGGCACCATTGCGTCCCCGTGGAGCACGGCGGCCGGCGCGCCCGATACCAATGGCTCGGGCGGCGCCGACGCGAAGCACCTGGATGTCGGCGATGCCAGCGACGATGAAAAGGATATGTCGGCGGCGGACGCGGAGGGAGTATGGAGTCCGGACATCGAGCAGAGCTTCCAAGAGGCGCTGGCGATATACCCTCCATGCGGGAGGCGGAAGATCATCCTCTCCGACGAGGGCAAGATGTACGGTGAGTTCGAGCATGCTAGAGGACCCGCTTTGATCCTGCTTAATGAGGGTTTCACGTTCAAGTGA
- Protein Sequence
- MKSKKRQEMMMTSGALAAGTIASPWSTAAGAPDTNGSGGADAKHLDVGDASDDEKDMSAADAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGEFEHARGPALILLNEGFTFK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01148065; iTF_00180457; iTF_01119315; iTF_01064646; iTF_00144553; iTF_00869613; iTF_00383635;
- 90% Identity
- -
- 80% Identity
- -