Basic Information

Insect: Coleophora flavipennella
Gene Symbol: -
Assembly: GCA_947284805.1
Location: OX369262.1:13233382-13234800[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 16 7.8e-06 0.00074 21.2 0.4 1 23 10 32 10 32 0.98

2 16 8.1e-09 7.7e-07 30.6 1.0 1 23 38 60 38 60 0.98

3 16 1.8e-07 1.7e-05 26.4 0.5 1 23 66 88 66 88 0.98

4 16 5.7e-08 5.4e-06 27.9 0.9 1 23 94 116 94 116 0.98

5 16 7.1e-07 6.7e-05 24.5 0.2 1 23 122 144 122 144 0.98

6 16 1.9e-07 1.8e-05 26.3 0.3 1 23 150 172 150 172 0.96

7 16 1.4e-06 0.00013 23.6 0.1 1 23 178 200 178 200 0.98

8 16 1.2e-05 0.0011 20.6 0.5 1 23 206 228 206 228 0.95

9 16 8e-08 7.5e-06 27.5 1.9 1 23 234 256 234 256 0.98

10 16 2.4e-07 2.2e-05 26.0 1.1 1 23 262 284 262 284 0.98

11 16 5.9e-08 5.5e-06 27.9 0.7 1 23 290 312 290 312 0.98

12 16 1e-06 9.5e-05 24.0 3.7 1 23 318 340 318 340 0.98

13 16 3.7e-07 3.5e-05 25.4 0.9 1 23 346 368 346 368 0.98

14 16 3.4e-07 3.2e-05 25.5 1.3 1 23 374 396 374 396 0.98

15 16 0.11 10 8.2 2.8 1 23 402 425 402 425 0.95

16 16 0.0018 0.17 13.8 6.3 3 23 433 453 430 453 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	16	7.8e-06	0.00074	21.2	0.4	1	23	10	32	10	32	0.98
2	16	8.1e-09	7.7e-07	30.6	1.0	1	23	38	60	38	60	0.98
3	16	1.8e-07	1.7e-05	26.4	0.5	1	23	66	88	66	88	0.98
4	16	5.7e-08	5.4e-06	27.9	0.9	1	23	94	116	94	116	0.98
5	16	7.1e-07	6.7e-05	24.5	0.2	1	23	122	144	122	144	0.98
6	16	1.9e-07	1.8e-05	26.3	0.3	1	23	150	172	150	172	0.96
7	16	1.4e-06	0.00013	23.6	0.1	1	23	178	200	178	200	0.98
8	16	1.2e-05	0.0011	20.6	0.5	1	23	206	228	206	228	0.95
9	16	8e-08	7.5e-06	27.5	1.9	1	23	234	256	234	256	0.98
10	16	2.4e-07	2.2e-05	26.0	1.1	1	23	262	284	262	284	0.98
11	16	5.9e-08	5.5e-06	27.9	0.7	1	23	290	312	290	312	0.98
12	16	1e-06	9.5e-05	24.0	3.7	1	23	318	340	318	340	0.98
13	16	3.7e-07	3.5e-05	25.4	0.9	1	23	346	368	346	368	0.98
14	16	3.4e-07	3.2e-05	25.5	1.3	1	23	374	396	374	396	0.98
15	16	0.11	10	8.2	2.8	1	23	402	425	402	425	0.95
16	16	0.0018	0.17	13.8	6.3	3	23	433	453	430	453	0.93

Sequence Information

Coding Sequence: atgagtagtcacacaggagagaaaccatattcatgtttagaatgtaacaaagcattcagtgtactaggtcatttagcagagcacatgaagattcacacaggagagaaacgatattcatgtacagaatgtgacaaagtgttcagtaaaaaaggtaatttgacacaacacatgaggattcacactggagagaaaccatatccatgttctgaatgtgacaaagcattcagtgtaaaaggtcatttagaaaagcacatgagtattcacacaggtgagaaactatattcatgttcagaatgtgacaaagcattcagtgtaaaaggtcatttagcaaagcacatgaggattcacacaggtgtgaaaccatattcatgttcagaatgtgacaaagcattcagtgtaacaggttatttagcaaagcacatgaggattcacacaggtgagaaaccatatttatgttcagaatgtgacaaagcattcagcgaaaaaggtaatttggtaaaacacatgaggattcacacaggagaaaaaccatattcatgttctgaatgtgacaaagcattcagcgaaaaaggtggtttggtaagacacatgagtattcacacaggagagaaaccctatttatgttcagaatgtgacaaagcgttcagtgtaaaatatcatttagcaaaccacgcgatgattcatacaggagagaaaccatattcatgttcagaatgtgacaaagcattcagtgtaaaatatcatttagtaaagcacatgaggattcacactggagagaaaccatattcatgttctgaatgtgacaaagttttcacttaccaaggtagtttcacaagacacatgagtattcacacaggtgagaaaccatattcatgttcagaatgtgacaaagtgttcagcgaaaaaagtaatatggtaaaacacatgaggattcacactggagagaaaccatattcatgttctgattgtgacaaatttttcactcaccaaggtagtttcacaagacacatgagtattcacacaggtgagaaaccatattcatgttcagaatgtgacaaagtgttcagcgaaaaaagtaaaatggtaaaacacatgaggattcactcaaaagggaaaccatattcatgttcagagtgtgacaaagctttcagcaaacaaggtcattgggtaaaacacatgaggattcacacagaagagaaaccgtattcatgttcagaatgtaatatgaTGCTATTCTGTGACAGAAGTGCTTTTGTTAGACATCAGAGTAAACATAAGAGAGAGAACTGTCATTTATGTGTAGAATGTGACCAACAATTCCACCAAAAATCTTACCTGACAGCACACTTGAAGACACATGCAAAAAATAAACTTGCATGGATGTGGCTCGGATTTAAAGTAGGTAACAATGTAGAGTAG
Protein Sequence: MSSHTGEKPYSCLECNKAFSVLGHLAEHMKIHTGEKRYSCTECDKVFSKKGNLTQHMRIHTGEKPYPCSECDKAFSVKGHLEKHMSIHTGEKLYSCSECDKAFSVKGHLAKHMRIHTGVKPYSCSECDKAFSVTGYLAKHMRIHTGEKPYLCSECDKAFSEKGNLVKHMRIHTGEKPYSCSECDKAFSEKGGLVRHMSIHTGEKPYLCSECDKAFSVKYHLANHAMIHTGEKPYSCSECDKAFSVKYHLVKHMRIHTGEKPYSCSECDKVFTYQGSFTRHMSIHTGEKPYSCSECDKVFSEKSNMVKHMRIHTGEKPYSCSDCDKFFTHQGSFTRHMSIHTGEKPYSCSECDKVFSEKSKMVKHMRIHSKGKPYSCSECDKAFSKQGHWVKHMRIHTEEKPYSCSECNMMLFCDRSAFVRHQSKHKRENCHLCVECDQQFHQKSYLTAHLKTHAKNKLAWMWLGFKVGNNVE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -