Basic Information

Transcription Factor Domain

TF Family: HTH
Domain: HTH_psq domain
PFAM: PF05225
TF Group: Helix-turn-helix
Description: This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 1.2e-09 8.9e-07 29.4 0.1 17 42 1 27 1 28 0.95

2 6 8.3e-10 6.2e-07 29.9 0.1 17 42 31 57 29 58 0.94

3 6 8.3e-10 6.2e-07 29.9 0.1 17 42 61 87 59 88 0.94

4 6 8.3e-10 6.2e-07 29.9 0.1 17 42 91 117 89 118 0.94

5 6 8.8e-10 6.6e-07 29.8 0.1 17 42 124 150 122 151 0.94

6 6 8.3e-10 6.2e-07 29.9 0.1 17 42 154 180 152 181 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	1.2e-09	8.9e-07	29.4	0.1	17	42	1	27	1	28	0.95
2	6	8.3e-10	6.2e-07	29.9	0.1	17	42	31	57	29	58	0.94
3	6	8.3e-10	6.2e-07	29.9	0.1	17	42	61	87	59	88	0.94
4	6	8.3e-10	6.2e-07	29.9	0.1	17	42	91	117	89	118	0.94
5	6	8.8e-10	6.6e-07	29.8	0.1	17	42	124	150	122	151	0.94
6	6	8.3e-10	6.2e-07	29.9	0.1	17	42	154	180	152	181	0.94

Coding Sequence: ATGTCCATCAACCAGGCGGCGATCCACTACAACCTGCCCTACTCGTCGCTGTACGGCCGCTTCAAGCGCTGCAAGtaccagcccgcgccgatgtccatcaaccaggcggcgatccactacaacctgccctactcgtcgctgtacggccgcttcaagcgctgcaagtaccagcccgcgccgatgtccatcaaccaggcggcgatccactacaacctgccctactcgtcgctgtacggccgcttcaagcgctgcaagtaccagcccgcgccgatgtccatcaaccaggcggcgatccactacaacctgccctactcgtcgctgtacggccgcttcaagcgctgcaagtaccagcccgcgccggtgagtctcatgtccatcaaccaggcggcgatccactacaacctgccctactcgtcgctgtacggccgcttcaagcgctgcaagtaccagcccgcgccgatgtccatcaaccaggcggcgatccactacaacctgccctactcgtcgctgtacggccgcttcaagcgctgcaagtaccagcccgcgccggtgagtctcactaatgtgcagggtgggtcagatgtccatcaaccaggcggcgatccactacaacctgccctactcgtcgctgtacggccgcttcaagcgctgcaagtaccagcccgcgccggtgagtctcactaa
Protein Sequence: MSINQAAIHYNLPYSSLYGRFKRCKYQPAPMSINQAAIHYNLPYSSLYGRFKRCKYQPAPMSINQAAIHYNLPYSSLYGRFKRCKYQPAPMSINQAAIHYNLPYSSLYGRFKRCKYQPAPVSLMSINQAAIHYNLPYSSLYGRFKRCKYQPAPMSINQAAIHYNLPYSSLYGRFKRCKYQPAPVSLTNVQGGSDVHQPGGDPLQPALLVAVRPLQALQVPARAGESH

Sequence clustering based on sequence similarity using MMseqs2