Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0037 0.3 12.6 3.8 1 23 49 72 49 72 0.95

2 6 3.5 2.8e+02 3.2 0.1 1 20 80 98 80 102 0.69

3 6 0.00015 0.012 16.9 4.1 2 23 108 130 108 130 0.95

4 6 6.3e-08 5.1e-06 27.6 0.8 1 23 136 158 136 158 0.98

5 6 0.00054 0.043 15.2 0.6 1 23 164 186 164 186 0.97

6 6 8.4e-06 0.00067 20.9 0.9 3 23 197 218 196 218 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0037	0.3	12.6	3.8	1	23	49	72	49	72	0.95
2	6	3.5	2.8e+02	3.2	0.1	1	20	80	98	80	102	0.69
3	6	0.00015	0.012	16.9	4.1	2	23	108	130	108	130	0.95
4	6	6.3e-08	5.1e-06	27.6	0.8	1	23	136	158	136	158	0.98
5	6	0.00054	0.043	15.2	0.6	1	23	164	186	164	186	0.97
6	6	8.4e-06	0.00067	20.9	0.9	3	23	197	218	196	218	0.98

Coding Sequence: ATGGTCACGGAATTCTACACCAAAACGGAACTCTTCTACAATTTTCCCGGTCCGATAAGGACCTTGGGCTGgttcaGTTTACAGAGTCATGAAGACGGCATCGCTAGTTTCTGCACCATAGCCGAAAACGACGGAAGCAAAGAGTACACCTGCATCGTATGCGAGCGCGTGTTCAAGAAATGGGCACACTTCTCCCAACACTACAGACACGTGCACCTCAAACAAAGGAGGAAGACTTACCCATGTGTCGAATGTGGCGAAGAGCTCTTCCCTTGGCTGAAATCTAAACACATGGAGGAGGCCCACGGCTGGCCGGCGCCTACTTGCGAACTGTGCGGCAGGAAATTCGCGTACCCCCATCAACTTACAAACCATCACAAGCAGTTTCACTTGAAACTGAAGGAGTACAAGTGCACGGAGTGTGAAAAGAGCTTTCCTTCACTGAAGAATTTGAAGCGACACATGGGGATTCATACGGATGCTAAGGACTACGCTTGTGCGTTTTGCTCGAAGGGATTTAAGTCGGTGAAGATGTTGAAGGAACATACGCAGATACATTTGAATGATAAGCTTGAGAAGAAGCACGGTTGCGCGCATTGCGACGCGGCGTTTGTCCAATCAGGCAGTTTGAAGAGACACATGAAGAAACAGCATCCTGATGTGCCGATTTAG
Protein Sequence: MVTEFYTKTELFYNFPGPIRTLGWFSLQSHEDGIASFCTIAENDGSKEYTCIVCERVFKKWAHFSQHYRHVHLKQRRKTYPCVECGEELFPWLKSKHMEEAHGWPAPTCELCGRKFAYPHQLTNHHKQFHLKLKEYKCTECEKSFPSLKNLKRHMGIHTDAKDYACAFCSKGFKSVKMLKEHTQIHLNDKLEKKHGCAHCDAAFVQSGSLKRHMKKQHPDVPI

Sequence clustering based on sequence similarity using MMseqs2