Ctib001424.1
Basic Information
- Insect
- Chorisops tibialis
- Gene Symbol
- -
- Assembly
- GCA_963669355.1
- Location
- OY770262.1:30069000-30069455[+]
Transcription Factor Domain
- TF Family
- SAND
- Domain
- SAND domain
- PFAM
- PF01342
- TF Group
- Other Alpha-Helix Group
- Description
- The DNA binding activity of two proteins has been mapped to the SAND domain. The conserved KDWK motif is necessary for DNA binding, and it appears to be important for dimerisation [1]. This region is also found in the putative transcription factor RegA from the multicellular green alga Volvox cateri. This region of RegA is known as the VARL domain [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4.7e-05 0.078 14.1 0.1 4 24 19 39 16 42 0.89 2 2 1.4e-16 2.3e-13 51.0 0.5 9 70 42 104 39 109 0.91
Sequence Information
- Coding Sequence
- atgaCAACTTTCTGCGCAAGTGCGAGGAAAAAAGCGCGCAATGTGGAAGATACTCGCAATGTTTTTAAAGTTAgatgcaaaaaagaaaaaggtaAGCTTCATGAACAGAAATTTGGATTCGATGCTACATGCAACAACGAACtgggcgaattagatacaacaaaATTGAGATCGTGTAATAGTGGTCACTGCATTAAATATAAGGAAGAATGGCTCACTCCGAAAGAATTTATGCTTCGCAGCGGATTGGTAAGATTTGGTAATTGGAAAGAACGAATCCACTGTGACGACGGCCGCAATTTACATGAGGTGCTCCTAAAAAGTGTCCCGCTTGCGAAATGTAAATGTGAAGAATGCCGCGATAGTGAAACCGCAAAAGAGGAAGAACGCATTCGTCAGAAAGCGGAAACATTTGCAACAACTACGTATTTGAAATTCGATGCAAAAAGGAAATAG
- Protein Sequence
- MTTFCASARKKARNVEDTRNVFKVRCKKEKGKLHEQKFGFDATCNNELGELDTTKLRSCNSGHCIKYKEEWLTPKEFMLRSGLVRFGNWKERIHCDDGRNLHEVLLKSVPLAKCKCEECRDSETAKEEERIRQKAETFATTTYLKFDAKRK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -