Cfor001046.1
Basic Information
- Insect
- Chelonus formosanus
- Gene Symbol
- kn
- Assembly
- GCA_028641665.1
- Location
- CM054000.1:6370697-6378709[-]
Transcription Factor Domain
- TF Family
- COE
- Domain
- COE domain
- PFAM
- AnimalTFDB
- TF Group
- Helix-turn-helix
- Description
- This is the helix-loop-helix domain of transcription factor COE. It is responsible for dimerisation [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.1e-42 2.3e-38 132.2 0.0 27 118 14 100 4 119 0.87
Sequence Information
- Coding Sequence
- ATGAGACAAATCCTCAAAGAAGAACCTGTACCACGTGCTTGGCCTCAACCTGCTGCTCTCACTGATAACACCACGGTTGGTGTTGGAAGGGCGCACTTTGAAAAACAACCACCAAGTAATTTGAGgaagagtaatttttttcattttgttattGCACTTTATGATCGGGGTGGACAACCAATTGAAATTGAGAGGACTGCTTTCATTGGATTTGTTGAAAAAGACcagGAATCAGAAGGTCAAAAGACCAACAATGGAATCCAATACAGACTCCAATTACTCTACGCCAATGGTGAGTgtcatttttttgaaattaattccaGAACGATTTACGATGGTGGATCGCGTTTGTGTCTTTGTCTTGAATGTGACTGA
- Protein Sequence
- MRQILKEEPVPRAWPQPAALTDNTTVGVGRAHFEKQPPSNLRKSNFFHFVIALYDRGGQPIEIERTAFIGFVEKDQESEGQKTNNGIQYRLQLLYANGECHFFEINSRTIYDGGSRLCLCLECD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01464830;
- 90% Identity
- -
- 80% Identity
- -