Basic Information

Insect: Cheilosia scutellata
Gene Symbol: -
Assembly: GCA_955612985.1
Location: OY015313.1:49436469-49441622[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 3e-05 0.0036 18.4 1.4 1 23 90 112 90 112 0.98

2 7 1.1e-07 1.3e-05 26.1 0.8 1 23 118 140 118 140 0.99

3 7 0.00032 0.037 15.2 1.3 1 23 146 168 146 168 0.97

4 7 7.7e-05 0.0091 17.2 0.2 1 23 174 196 174 196 0.98

5 7 0.0013 0.15 13.3 4.0 1 23 202 224 202 224 0.98

6 7 1.1e-05 0.0012 19.9 1.0 1 23 230 252 230 252 0.97

7 7 0.0026 0.3 12.4 0.1 1 23 258 280 258 280 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	3e-05	0.0036	18.4	1.4	1	23	90	112	90	112	0.98
2	7	1.1e-07	1.3e-05	26.1	0.8	1	23	118	140	118	140	0.99
3	7	0.00032	0.037	15.2	1.3	1	23	146	168	146	168	0.97
4	7	7.7e-05	0.0091	17.2	0.2	1	23	174	196	174	196	0.98
5	7	0.0013	0.15	13.3	4.0	1	23	202	224	202	224	0.98
6	7	1.1e-05	0.0012	19.9	1.0	1	23	230	252	230	252	0.97
7	7	0.0026	0.3	12.4	0.1	1	23	258	280	258	280	0.97

Sequence Information

Coding Sequence: ATGTCTCTTAATCTCCTGTATTGTGTTCCAATGCAACTCCTACTTTCGTTTCAACTCACGGCCTTAAAAAATCCAAAAACATATAAACCCGAAGACTATTCAGAAAGCTGTACCGGCTCCGTGTTCGAAGGAAAGGACCCACCCGTCGAGAATAGTACCACATCCAAGGCTAAaccccaacaacaacaacttgaTCGGCCTTCGAGTTGCACGTCAGAGGTGCACATAAATCCCCTACTCTCATCTTATGCTACTACTAACAACATATTTGAATGTCCACATTGTcctgaaaaattcaaaattgaatttgatttgaaaaatcATCTCAAACTCCATGAATCCACACGTAAATACAAGTGCGAAATATGCGGCTTTCGCTTCACTATGCTCTCTAATCTACGTGCTCACGTGCGCCGCCATATCGGCGAAAAACAATTCGCCTGCGATGAATGTGAAAAGCGTTTTTGGACAACAACCGAATTGAACACTCACCGACGAAAACACACCGGTGAGCGACCCTTCCCTTGTGAGTTCTGTGGAAGTGGATTCAAGACATCCGGTGCTCTAACAGATCACGAAAAACGACACACTCAAAAGAAACGTCACAAATGCAGCGAATGCGATCGTAGCTTCCTCCATCTACAAGTATTACGTGAGCATATGAACACCCACACATTGGATCGTCCGTTCGTCTGCAAAGTATGTAATGCAAACTTTTCGCGAAAGAATAGTTTAACGCAACACTTGAGCCTTCATTCGACCGAAAAGAAGTACAACTGTGATGTATGCCTAAAGGATTTCGCCCAATTACCGGGCCTATTGTCACACAAGAGACTTCATGAAGTCAGCAGTCAAATGgggGCTCCCGAGAGTTTTATTGGCTTGATAAACATTGATAACCGAAGGCGATTATCAATAAACCAACAGTCGCAAATCGCAATCGGCGGCCACTTGAAGAATTTCATTATTTCGTCATAA
Protein Sequence: MSLNLLYCVPMQLLLSFQLTALKNPKTYKPEDYSESCTGSVFEGKDPPVENSTTSKAKPQQQQLDRPSSCTSEVHINPLLSSYATTNNIFECPHCPEKFKIEFDLKNHLKLHESTRKYKCEICGFRFTMLSNLRAHVRRHIGEKQFACDECEKRFWTTTELNTHRRKHTGERPFPCEFCGSGFKTSGALTDHEKRHTQKKRHKCSECDRSFLHLQVLREHMNTHTLDRPFVCKVCNANFSRKNSLTQHLSLHSTEKKYNCDVCLKDFAQLPGLLSHKRLHEVSSQMGAPESFIGLINIDNRRRLSINQQSQIAIGGHLKNFIISS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00314614;
90% Identity: iTF_00313757;
80% Identity: -