Basic Information

Insect: Cantharis nigra
Gene Symbol: Zbtb41
Assembly: GCA_958510845.1
Location: OY294029.1:12734389-12735174[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 4.8e-06 0.00025 22.1 0.3 1 23 10 32 10 32 0.98

2 8 3.8e-07 2e-05 25.6 1.1 1 23 38 60 38 60 0.99

3 8 0.0012 0.062 14.6 2.3 2 23 65 86 64 86 0.97

4 8 0.0016 0.085 14.2 2.2 3 23 114 134 112 134 0.97

5 8 0.0013 0.067 14.5 7.1 1 23 140 163 140 163 0.96

6 8 3.2e-06 0.00017 22.7 1.0 1 23 171 193 171 193 0.98

7 8 3.1e-05 0.0016 19.6 3.2 1 23 199 221 199 221 0.99

8 8 0.029 1.5 10.2 0.3 1 20 227 246 227 248 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	4.8e-06	0.00025	22.1	0.3	1	23	10	32	10	32	0.98
2	8	3.8e-07	2e-05	25.6	1.1	1	23	38	60	38	60	0.99
3	8	0.0012	0.062	14.6	2.3	2	23	65	86	64	86	0.97
4	8	0.0016	0.085	14.2	2.2	3	23	114	134	112	134	0.97
5	8	0.0013	0.067	14.5	7.1	1	23	140	163	140	163	0.96
6	8	3.2e-06	0.00017	22.7	1.0	1	23	171	193	171	193	0.98
7	8	3.1e-05	0.0016	19.6	3.2	1	23	199	221	199	221	0.99
8	8	0.029	1.5	10.2	0.3	1	20	227	246	227	248	0.94

Sequence Information

Coding Sequence: ATGCGAGTTCATACGGGAGATAAGCCATTCGTGTGCGAAATATGCAAAAATGCTTTCGCAACCAATAGTACGTTGAATACTCACATGGTAACTCattcaaaagaaaaacaatatgTGTGTGGTATTTGTGGTAAAAGCTATAGCCAAAAAATGACGCTAAAATATCACTTGAAGACACACTCCATCCAGTTAACTTGTCATATTTGTAACGGACATTTTTCCACTCGCAATGAATTGGCGTATCATGTAGAAACGCATTCGAagttgaatttaaaacaaaacgtAGAGGTTCCCAGCGTACTGGTTCCCGTAGCCCTCACCCAAGAAAACAAgctattttgcaaaatttgcagCAAGACATGTGCATCTCAACGTTTATTTGATGTACATCTGAGGATCCATACCGGAGAAAAACCGTTCAGGTGTTCCAAGTGCGATAAATTTTTTACACATTTCAGAAATTTAGAGTATCACAACAAAAGTTTtcattccaaaaaaaattcgtCAAGTTTTTCTTGCTCCATCTGCAACAAGACCTACAATGTTGAAAAAACTTTGAAGATTCACATGCGGATTCACACGggtgaaaatttgtataaatgtGATTTATGTTCGTACGTGTGTCCGACGAAATCCGCGTTTGAAAAGCACACAAGAACccatacgggggaaaaacccTTCGAGTGTAATGAATGCGAATTTAAAGCCGTGTCGAAGCAAGGCCTGAAACACCATATCACCATAGCTTCACcgaagaatttaataattgtaatatttgcgATATAA
Protein Sequence: MRVHTGDKPFVCEICKNAFATNSTLNTHMVTHSKEKQYVCGICGKSYSQKMTLKYHLKTHSIQLTCHICNGHFSTRNELAYHVETHSKLNLKQNVEVPSVLVPVALTQENKLFCKICSKTCASQRLFDVHLRIHTGEKPFRCSKCDKFFTHFRNLEYHNKSFHSKKNSSSFSCSICNKTYNVEKTLKIHMRIHTGENLYKCDLCSYVCPTKSAFEKHTRTHTGEKPFECNECEFKAVSKQGLKHHITIASPKNLIIVIFAI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -