Basic Information

Insect: Cantharis lateralis
Gene Symbol: -
Assembly: GCA_963170105.1
Location: OY720628.1:36075295-36076281[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 6.4e-07 3.3e-05 24.8 0.8 1 23 56 78 56 78 0.98

2 9 8.2e-05 0.0043 18.2 3.0 1 23 102 124 102 124 0.99

3 9 0.32 16 6.9 3.7 1 23 130 152 130 152 0.98

4 9 0.0051 0.26 12.6 6.7 1 23 158 181 158 181 0.97

5 9 8.6e-06 0.00045 21.3 0.5 3 23 189 209 187 209 0.98

6 9 0.00034 0.018 16.3 9.1 1 23 215 237 215 237 0.99

7 9 8.5e-06 0.00044 21.3 1.3 1 23 243 265 243 265 0.98

8 9 0.00018 0.0095 17.1 7.8 1 23 271 293 271 293 0.99

9 9 8.3e-05 0.0043 18.2 5.9 1 23 299 321 299 321 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	6.4e-07	3.3e-05	24.8	0.8	1	23	56	78	56	78	0.98
2	9	8.2e-05	0.0043	18.2	3.0	1	23	102	124	102	124	0.99
3	9	0.32	16	6.9	3.7	1	23	130	152	130	152	0.98
4	9	0.0051	0.26	12.6	6.7	1	23	158	181	158	181	0.97
5	9	8.6e-06	0.00045	21.3	0.5	3	23	189	209	187	209	0.98
6	9	0.00034	0.018	16.3	9.1	1	23	215	237	215	237	0.99
7	9	8.5e-06	0.00044	21.3	1.3	1	23	243	265	243	265	0.98
8	9	0.00018	0.0095	17.1	7.8	1	23	271	293	271	293	0.99
9	9	8.3e-05	0.0043	18.2	5.9	1	23	299	321	299	321	0.98

Sequence Information

Coding Sequence: ATGGAAAAAGCAATCCAGTTCGAAGGGTACTATGAATATGAAGTCAAGAAAGAAGCAGAGGAAGACGTAAAATTCAACTTGGAAGACTTACATCATTCGATTGATATTAAGGAAGAAAAACTTTCCGAGCTGGACATAAAACCGGAAgcagaaaaatgtaaattattcaaatgtgAGGTCTGTAACGAAACATTTACTGTCAAGTCGCAACTAACGAATCATGTAAAAATTCATTCCGAACCTGAAATATTTGTATGCGGCCTGACCGATAAGAATATTTCTCATCGCGATGGTATTAAACTATTCAAATGCGAAGTCTGCGACTTCAAATGTTCCATTAAGCAAAGCCTGATCAGGCATATAAGGACTCATACCGGTGAGAAGCCCTTCTCGTGtgagttttgtaaatttaagagtGCCCGTAAACATACTATAAAAGAGCACGTAAAGATCCATACCGGGGACAAGCCGTTTGCTTGTAAAATGTGTGCGTGTAAATGTAGGACCcaacaaaatttgaagcaGCATATCCGGAGAACTCATAGCGGTGAGAAACCTTTCGGGTGCGAGATTTGTGACTACAAATATTCGTCCAAACGAGATTTGATGCTGCACATCAGgactcataccggcgagaaaccgttcAAGTGTTGCATTTGCAATTGTAAATATACTCGAAAAGCACATTTGAAAGCTCATTTGCAAACTCATACCGCCCAGAAACCGTTCGTGTGCaatatttgtgattataaaactTACAAGAAAGGCAACCTAACGGATCACTTGAGAACGCATTCCGGCGAGAAACCCTTTCAGTGCAATATgtgcaattataaatgttgTAAAAAAGGAAACTTGAAAGATCACTTACGAACTCACACCGGCAGGAAACCGTTTGAGTGccacatttgcgattataaatgtaccCGAAAAGCATTTTTGAACCGACATCTACAAAGCCATATCGGCCAGTCTAACGTTGCTTGA
Protein Sequence: MEKAIQFEGYYEYEVKKEAEEDVKFNLEDLHHSIDIKEEKLSELDIKPEAEKCKLFKCEVCNETFTVKSQLTNHVKIHSEPEIFVCGLTDKNISHRDGIKLFKCEVCDFKCSIKQSLIRHIRTHTGEKPFSCEFCKFKSARKHTIKEHVKIHTGDKPFACKMCACKCRTQQNLKQHIRRTHSGEKPFGCEICDYKYSSKRDLMLHIRTHTGEKPFKCCICNCKYTRKAHLKAHLQTHTAQKPFVCNICDYKTYKKGNLTDHLRTHSGEKPFQCNMCNYKCCKKGNLKDHLRTHTGRKPFECHICDYKCTRKAFLNRHLQSHIGQSNVA

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -