Clat002900.1
Basic Information
- Insect
- Cantharis lateralis
- Gene Symbol
- -
- Assembly
- GCA_963170105.1
- Location
- OY720624.1:29563759-29564166[+]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.7e-13 1.2e-10 41.7 0.1 3 41 17 55 16 58 0.93 2 2 1.4 9.3e+02 0.4 0.0 19 30 101 112 101 113 0.86
Sequence Information
- Coding Sequence
- atggttcgtacttacaaaaaaaaaactaacagAGGCAACACTCCCGTGGAGGATTTTGAAAGAGCAGCACATGCTATTCGTGAGAAAAAACTGTCGATAAGAGGCGCCGCTCAAGAAtatggaataaattttatgacattACAACGTTACATAAAGAAGAGTTTGGCTGCTGAAAGCTCCAATCCGATATCAGTGGGTTATACGTTACATAGAAAAACATTTACCGATTATCAAGAGCAGGAACTTGCTACTTATGGTGCACATTCAGCGAAAATTTATTACGGGCTTACAACTAGAGATCTTCGAAAACTTGCTTACGAATATTCGATTGctaacaacattaaaattaaaacgatgTGTGGAAAACCAATTCAATGGCATCTAAGGATTGGTTATTCGGTTTCTTAA
- Protein Sequence
- MVRTYKKKTNRGNTPVEDFERAAHAIREKKLSIRGAAQEYGINFMTLQRYIKKSLAAESSNPISVGYTLHRKTFTDYQEQELATYGAHSAKIYYGLTTRDLRKLAYEYSIANNIKIKTMCGKPIQWHLRIGYSVS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -