Clat008989.1
Basic Information
- Insect
- Cantharis lateralis
- Gene Symbol
- CEBPG
- Assembly
- GCA_963170105.1
- Location
- OY720624.1:83725063-83725451[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.4 5.4e+02 1.5 0.1 14 28 1 15 1 17 0.80 2 2 4.7e-14 6.4e-11 42.9 6.3 2 65 21 84 20 84 0.95
Sequence Information
- Coding Sequence
- ATGTCACCTCGTAAAGGGCGCACGAaaaaggaagaagaagaaatggaATCTGGTGACGACTCAGACGAATACAGGAAGAAACGCGACCGAAATAATTTGGCTGTAAAGCGTAGTCGAattaaatcgaaaattaaaactcaGGAAACCTTGAAGAGAGTAAATcagttgaaaaatgaaaattcagtaTTAGAAGAGAAGGTTAAGAATTTGAGCAAGGAGTTGGGATTTTTGAAGGAGTTGTTTTTGGCTCACGCAGGCAATGCAGGTGACAAGTCGAAATTCGAAGGAAttgatttgcaaaaattgttaGAAGACAGTTCCAACGGTTAA
- Protein Sequence
- MSPRKGRTKKEEEEMESGDDSDEYRKKRDRNNLAVKRSRIKSKIKTQETLKRVNQLKNENSVLEEKVKNLSKELGFLKELFLAHAGNAGDKSKFEGIDLQKLLEDSSNG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00398583;
- 90% Identity
- iTF_01293321;
- 80% Identity
- iTF_01293321;