Basic Information

Insect: Cantharis flavilabris
Gene Symbol: -
Assembly: GCA_949152465.1
Location: OX424437.1:10160505-10161890[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 0.0053 0.34 12.5 0.1 2 23 58 79 57 79 0.96

2 14 0.00019 0.012 17.1 1.3 1 23 85 107 85 107 0.98

3 14 0.021 1.3 10.7 0.8 1 23 113 135 113 135 0.97

4 14 0.00068 0.043 15.4 4.2 1 23 141 163 141 163 0.97

5 14 1.5e-05 0.00097 20.6 2.7 3 23 171 191 169 191 0.98

6 14 4.9e-05 0.0032 18.9 4.9 1 23 197 219 197 219 0.99

7 14 2.2e-06 0.00014 23.2 3.6 1 23 225 247 225 247 0.99

8 14 0.0013 0.086 14.4 2.5 3 23 255 275 253 275 0.98

9 14 1.9e-05 0.0012 20.2 0.7 1 23 281 303 281 303 0.99

10 14 6e-05 0.0038 18.7 0.2 1 23 309 331 309 331 0.98

11 14 0.0052 0.33 12.6 4.4 1 23 337 359 337 359 0.99

12 14 0.00021 0.013 17.0 1.3 1 23 365 387 365 387 0.93

13 14 1.1e-05 0.00067 21.1 3.3 1 23 393 415 393 415 0.98

14 14 0.00042 0.027 16.0 3.3 1 23 421 443 421 443 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	0.0053	0.34	12.5	0.1	2	23	58	79	57	79	0.96
2	14	0.00019	0.012	17.1	1.3	1	23	85	107	85	107	0.98
3	14	0.021	1.3	10.7	0.8	1	23	113	135	113	135	0.97
4	14	0.00068	0.043	15.4	4.2	1	23	141	163	141	163	0.97
5	14	1.5e-05	0.00097	20.6	2.7	3	23	171	191	169	191	0.98
6	14	4.9e-05	0.0032	18.9	4.9	1	23	197	219	197	219	0.99
7	14	2.2e-06	0.00014	23.2	3.6	1	23	225	247	225	247	0.99
8	14	0.0013	0.086	14.4	2.5	3	23	255	275	253	275	0.98
9	14	1.9e-05	0.0012	20.2	0.7	1	23	281	303	281	303	0.99
10	14	6e-05	0.0038	18.7	0.2	1	23	309	331	309	331	0.98
11	14	0.0052	0.33	12.6	4.4	1	23	337	359	337	359	0.99
12	14	0.00021	0.013	17.0	1.3	1	23	365	387	365	387	0.93
13	14	1.1e-05	0.00067	21.1	3.3	1	23	393	415	393	415	0.98
14	14	0.00042	0.027	16.0	3.3	1	23	421	443	421	443	0.98

Sequence Information

Coding Sequence: ATGGATATGAATAAACTGGTGTTTTCGGAAGAATTAGTAAAAAGTGAATACCAAGAAATTAAAACAGAATGCCTGGATATCAAATTTGAAGActtgcatcattccatcgagATTAAAGAAGAGATTTCCGTTAAAGAATATCCACTGGATGAAGATTGCAAAACACATGTGGAATGTCTGGTATGTAATGTGATGTTTACTGATGCACTGCAACTTCGGGAgcatgaaaaaattcataacgGAGAGAAAGTGTTTCAGTGTTATCTTTGCAATTATAAATCTTCTCGAAAGGCGGATTTGCAAAATCACGTGCTGACTCATATGGGGGAGAAGGCGTTTGCGTGTaaattttgcgattataaagGCGCTTACAAAAGGCTGTTGCAGGGTCATGAACGGACTCATACCGAAAAGAAACCGTTCCAGTGTAAAATGTGCAATTTTAAATGCTTTCAAAAAGGGCTGCTAGAAATTCATTTGCGAACTCACACCGGAGAGAAACCGTTTGGTTGTTCAatttgcaattgtaaattttcaaataaaggCCAACTGAAGAGACACATTCAAATTCACACCGGCGAGAAGCCCTTCCAGTGCAAAATCTGTGACTTTAAATGCAGTCAAAAAGGCCATTTGAATGTTCACTTACTTACTCACActggggaaaaaccgtttgagtgcaacATTTGCAAGCATAAATTTTCCCAAAAGGCGCAATTGAGAGATCATTTGCGaactcacaccggcgaaaagccgtttggctgcaaaatttgcaaatttaaattctctcTGAAGCAAACTTTGAAAAATCATTTACTAACGCATTCTGATGAGAAGCCGTTTAAGTGTgaagtttgcgattataaagcTTCTCGAAAAACAAACCTGATCTACCATATACGAATTCACACAGGCGAGAAGCCATTTGAGTGTaaagtttgcgattataaatcttcACGTCCAGGAGATTTAAGAGAACACGTGCGAGGGCATTTcggcgaaaaaccgtatgagtgtacattttgtgattataaatcttCTCGAAGAGGATCTCTGAAATGTCACATACGAACACATACCGGGGAGAAATCGTTTGAGTGTAAAatatgcgattataaatgttctcgaaAAGCAGATTTGAATATCCATTCAGTAATCCATTCGGACaagaaaccgtttgagtgcaaaatttgtgattatagATGTTCTCGGAAAGTATATTTGAAAGCCCACTTGCAAACTCATTCAGCCGAGAAACTGTTCCAGTGTAACAATTGCAATTATAAAGCTTCTCAAAAGATGTATTTGAAAAGACATTTACAAAAACATACCAAGGACTATGTTAGCCGCCCAATGTCACCCTTAATAGTACCCAAATCCGAATAA
Protein Sequence: MDMNKLVFSEELVKSEYQEIKTECLDIKFEDLHHSIEIKEEISVKEYPLDEDCKTHVECLVCNVMFTDALQLREHEKIHNGEKVFQCYLCNYKSSRKADLQNHVLTHMGEKAFACKFCDYKGAYKRLLQGHERTHTEKKPFQCKMCNFKCFQKGLLEIHLRTHTGEKPFGCSICNCKFSNKGQLKRHIQIHTGEKPFQCKICDFKCSQKGHLNVHLLTHTGEKPFECNICKHKFSQKAQLRDHLRTHTGEKPFGCKICKFKFSLKQTLKNHLLTHSDEKPFKCEVCDYKASRKTNLIYHIRIHTGEKPFECKVCDYKSSRPGDLREHVRGHFGEKPYECTFCDYKSSRRGSLKCHIRTHTGEKSFECKICDYKCSRKADLNIHSVIHSDKKPFECKICDYRCSRKVYLKAHLQTHSAEKLFQCNNCNYKASQKMYLKRHLQKHTKDYVSRPMSPLIVPKSE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00271573;
90% Identity: iTF_00271573;
80% Identity: -