Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 2.4e-05 0.021 14.9 0.7 16 41 6 28 3 29 0.91

2 11 0.22 2e+02 2.2 0.7 18 38 36 57 32 59 0.88

3 11 0.12 1.1e+02 3.1 0.4 17 26 63 72 58 79 0.84

4 11 0.047 41 4.4 4.1 6 26 80 100 75 107 0.78

5 11 0.56 4.9e+02 0.9 3.6 12 28 114 130 101 137 0.77

6 11 0.0017 1.5 9.0 1.3 2 43 133 170 132 171 0.81

7 11 0.0014 1.2 9.3 0.3 16 44 181 206 174 206 0.90

8 11 2.4e-05 0.021 14.9 0.7 16 41 213 235 210 236 0.91

9 11 0.21 1.9e+02 2.3 0.7 18 38 243 264 239 268 0.89

10 11 0.17 1.5e+02 2.6 0.9 17 26 270 279 264 283 0.82

11 11 0.0012 1.1 9.4 5.1 5 42 286 320 282 324 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	2.4e-05	0.021	14.9	0.7	16	41	6	28	3	29	0.91
2	11	0.22	2e+02	2.2	0.7	18	38	36	57	32	59	0.88
3	11	0.12	1.1e+02	3.1	0.4	17	26	63	72	58	79	0.84
4	11	0.047	41	4.4	4.1	6	26	80	100	75	107	0.78
5	11	0.56	4.9e+02	0.9	3.6	12	28	114	130	101	137	0.77
6	11	0.0017	1.5	9.0	1.3	2	43	133	170	132	171	0.81
7	11	0.0014	1.2	9.3	0.3	16	44	181	206	174	206	0.90
8	11	2.4e-05	0.021	14.9	0.7	16	41	213	235	210	236	0.91
9	11	0.21	1.9e+02	2.3	0.7	18	38	243	264	239	268	0.89
10	11	0.17	1.5e+02	2.6	0.9	17	26	270	279	264	283	0.82
11	11	0.0012	1.1	9.4	5.1	5	42	286	320	282	324	0.79

Coding Sequence: ATGGGTGTTGATCTTTCTGTAGTGTGTGAAATGTGCGGTAAGAGAATCTCCAATAGGACTCGTTTGGTGAGGCACTTGAGGACCCACACTGGTCAGAAGCCATTTTCTTGCGATGTTTGCGGTAGGAGCTTTGCTAGCAAGTGTTTGGTTACGTCTCATATGAGGGTTCACACTGGAGAAAAACCCTACGTCTGCGTATATTGTGGCAAAAGGTTTGGACAGTCTGCTCCTTATAGGTACCACGTGAAGATACACACTGTAGAGAAGAAGTATGTTTGTAAGCTTTGCAACAAAGCTTGTGTGATATCTTATTTTTGTTTCAATCGATGCAAACACATCCTTAGATATAGACGGTACAGATGCGAGGTTTGCCGAAAGATCCTCAAGAAGCAATCGGTGGCCTTGAAGCATTCAGACAACCATTCCAACAGTGCCTTCTTCCAATGCGAGATATGTGGGAGAAAGCTGGCCAGTGCGAAGAGTTTGGACATGCATATGAACACTATCCATCACGAGATAGTGACGGGAATGCCTTTGTCCAAATACGACTGTCCACTCTGCAAAAAGCACTATGAATCTGAGACAGGATTGAGGAGGCACTATTCTAGCCAACACAAAGAGATGGGCGTTGATCTTTCGGTAGTGTGTGAGATGTGCGGTAAAAGAATCTCCAATAGGACTCGTTTGGTGAGGCACTTAAGGACCCACACTGGTCAGAAGCCATTTTCTTGCGATGTTTGCGGTAGGAGCTTTGCTAGCAAGTGTTTGGTTACGTCTCATATGAGGGTTCATACTGGAGAGAAACCATACGTCTGCGTATATTGTGGTAAAAGGTTTGGACAGTCTGCTCCTTATAGGTACCATGTGAAGATACACACTGGAGAGAAGAAGTATGTTTGTAAGCTTTGCAACAAAGGTTTTATCTCAAATAGTAATCTGAAGATCCATATGAAAACATGTACCAAACATCCCAAATGA
Protein Sequence: MGVDLSVVCEMCGKRISNRTRLVRHLRTHTGQKPFSCDVCGRSFASKCLVTSHMRVHTGEKPYVCVYCGKRFGQSAPYRYHVKIHTVEKKYVCKLCNKACVISYFCFNRCKHILRYRRYRCEVCRKILKKQSVALKHSDNHSNSAFFQCEICGRKLASAKSLDMHMNTIHHEIVTGMPLSKYDCPLCKKHYESETGLRRHYSSQHKEMGVDLSVVCEMCGKRISNRTRLVRHLRTHTGQKPFSCDVCGRSFASKCLVTSHMRVHTGEKPYVCVYCGKRFGQSAPYRYHVKIHTGEKKYVCKLCNKGFISNSNLKIHMKTCTKHPK

Sequence clustering based on sequence similarity using MMseqs2