Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.19 93 3.4 1.0 18 33 9 24 3 26 0.82

2 10 0.0053 2.6 8.3 1.5 3 31 23 52 21 64 0.85

3 10 0.2 1e+02 3.3 0.4 19 30 67 78 56 83 0.80

4 10 0.0051 2.5 8.4 1.2 8 39 88 113 81 117 0.74

5 10 0.049 24 5.2 5.2 18 44 123 146 119 146 0.89

6 10 3 1.5e+03 -0.5 0.2 18 29 152 163 149 170 0.80

7 10 0.0019 0.94 9.8 1.2 12 44 176 207 168 207 0.78

8 10 0.067 33 4.8 1.0 19 43 210 231 208 232 0.86

9 10 0.0033 1.7 9.0 0.4 16 39 236 256 228 262 0.83

10 10 0.0006 0.3 11.4 4.7 16 44 264 289 251 289 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.19	93	3.4	1.0	18	33	9	24	3	26	0.82
2	10	0.0053	2.6	8.3	1.5	3	31	23	52	21	64	0.85
3	10	0.2	1e+02	3.3	0.4	19	30	67	78	56	83	0.80
4	10	0.0051	2.5	8.4	1.2	8	39	88	113	81	117	0.74
5	10	0.049	24	5.2	5.2	18	44	123	146	119	146	0.89
6	10	3	1.5e+03	-0.5	0.2	18	29	152	163	149	170	0.80
7	10	0.0019	0.94	9.8	1.2	12	44	176	207	168	207	0.78
8	10	0.067	33	4.8	1.0	19	43	210	231	208	232	0.86
9	10	0.0033	1.7	9.0	0.4	16	39	236	256	228	262	0.83
10	10	0.0006	0.3	11.4	4.7	16	44	264	289	251	289	0.85

Coding Sequence: ATGCATAAATATACAAAATATCATGTTTGCGACGTTTGTGGTCAAAAGTATAAAAACAAAGAATCATTCAAAAATCATTATGCCAAACATCAAGGTATCATTGAACCAGCCGCACAATGTTCCATATGCAATAGGTGGCTTAAAAACAAGCACAGTCTGAGGTTGCATCGTTTTGTTCATGAGAAACACACAACACCATGCGACATATGTGGAAAGGTGTTTGATACCAAACATAGTCTGCGAAAACACAAGTCCTACTGGCACAAGTCCGACTTGAATTTACAGTGTAACTTTTGTGAGAAAGTTTTTCGACAAGAGCGTAATCTGCAAGAGCACATGGCTACACACACTGGAGTGCAGCTTTATAAATGTCCACATTGTCAAAAAGAATTTTGCTCGGAAAATAATTTAACGCGACATATCCATAATATACACAAATATATTAAATATCACATATGCGACGTTTGTGGTCAAAAGTTTAGAAACAAAGACTCATTCAATTTACATTACGCCCAGCATCAAGGCATCATTGAACCAGCCGCACAATGTTCTATATGCCAGAAATGGCTTAAAAACAAAAACACCCTTAGATTGCATCGTTTTGTTCATGAGAAACATCCAACACCGTGCGACATATGTGGAAAGTTATTTGAGACCAAGCATAGACTGCGCCGACACATATCCTACTGGCACAAGTCCGACGTCAATTTACAGTGTAACTTTTGTGAGAAAGTTTTTCGAGAAGAGCGCAATCTGAAAGAACACATGGCTATACATACAGGAGTGCAGCTTTATAAATGTCCACATTGTCAAAAAGAGTCACGTTCAAAATCAAATATGTACGCTCATATAAAGAGACAGCATCCAACGGAATGGTTTAAATCTAAAATGGAACGTTTAAATATAGATCCAAAAACCGGAAATCTTTAA
Protein Sequence: MHKYTKYHVCDVCGQKYKNKESFKNHYAKHQGIIEPAAQCSICNRWLKNKHSLRLHRFVHEKHTTPCDICGKVFDTKHSLRKHKSYWHKSDLNLQCNFCEKVFRQERNLQEHMATHTGVQLYKCPHCQKEFCSENNLTRHIHNIHKYIKYHICDVCGQKFRNKDSFNLHYAQHQGIIEPAAQCSICQKWLKNKNTLRLHRFVHEKHPTPCDICGKLFETKHRLRRHISYWHKSDVNLQCNFCEKVFREERNLKEHMAIHTGVQLYKCPHCQKESRSKSNMYAHIKRQHPTEWFKSKMERLNIDPKTGNL

Sequence clustering based on sequence similarity using MMseqs2