Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00063 0.55 10.7 4.7 5 40 24 56 20 60 0.91

2 6 2.7e-05 0.024 15.0 2.0 17 41 73 94 66 96 0.86

3 6 0.075 66 4.0 0.4 17 30 101 114 95 123 0.78

4 6 0.00019 0.17 12.3 2.4 14 40 126 149 114 152 0.83

5 6 0.0039 3.4 8.2 0.1 18 39 158 176 155 179 0.73

6 6 1 9.1e+02 0.4 0.8 8 27 177 195 174 207 0.70

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00063	0.55	10.7	4.7	5	40	24	56	20	60	0.91
2	6	2.7e-05	0.024	15.0	2.0	17	41	73	94	66	96	0.86
3	6	0.075	66	4.0	0.4	17	30	101	114	95	123	0.78
4	6	0.00019	0.17	12.3	2.4	14	40	126	149	114	152	0.83
5	6	0.0039	3.4	8.2	0.1	18	39	158	176	155	179	0.73
6	6	1	9.1e+02	0.4	0.8	8	27	177	195	174	207	0.70

Coding Sequence: ATGCACTGCCTCAACATATGTAGACGTGACACGTGTAAACGATGCTTTTACAGAAAGGACTTGCTGGCTAGACATGCGAAAATACACAAGCAAATAGAAAAATGTTTCGAATGTGATGTTTGCAACAAAAAGTTTCATAGAAGGGATAACCTCAAGTCACACATGAAAGTCCACAACAGTCCGGGCGAAAGCGGTGGCAATGCAAGCAAGAACACCTGTTTGTGTCTGTACTGCGGTCGAAGCTTCTCGAACTCTTCCAACTTAATAGTTCACATGCGACGTCACACCGGCGAGAAACCTTACAAATGCGACTTTTGTGGGAAAGGTTTTCCTCGATCATCAGATTTGCAGTGCCATCGACGCTCGCACACGGGAGAAAAGCCTTGTATATGTGGAGTATGTGGCAAAGCGTTCTCACGAAGTAACAAGCTATCACGCCACATGCGTGTTCACACTGGCGTGAAACCGTACAAGTGTCCGTACTGCGAGAAGGCTTTCTCCCAAAGCAACGACCTAACCCTTCACGTGAGGCGGCACACCGGTGACAAGCCGTACGTGTGCGAGCTGTGTGGTGACCGCTTTATACAGGGCACAGCTCTGCACAACCACAGACGCGCGCACGGCCACTACCCGACGGCGCCGCTCGTGTACACCGTGCAGACCCTCGCGCAGACGAACTGA
Protein Sequence: MHCLNICRRDTCKRCFYRKDLLARHAKIHKQIEKCFECDVCNKKFHRRDNLKSHMKVHNSPGESGGNASKNTCLCLYCGRSFSNSSNLIVHMRRHTGEKPYKCDFCGKGFPRSSDLQCHRRSHTGEKPCICGVCGKAFSRSNKLSRHMRVHTGVKPYKCPYCEKAFSQSNDLTLHVRRHTGDKPYVCELCGDRFIQGTALHNHRRAHGHYPTAPLVYTVQTLAQTN

Sequence clustering based on sequence similarity using MMseqs2