Basic Information

Insect: Brachypterus glaber
Gene Symbol: -
Assembly: GCA_958510825.1
Location: OY294045.1:1573014-1573934[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.38 22 6.7 3.4 1 23 17 39 17 39 0.97

2 10 0.0042 0.24 12.8 0.1 3 23 49 70 47 70 0.90

3 10 0.0014 0.078 14.4 1.1 1 23 75 97 75 97 0.97

4 10 0.09 5.1 8.7 0.9 7 23 111 128 108 128 0.95

5 10 5.5e-06 0.00031 21.9 1.7 1 23 133 155 133 155 0.99

6 10 0.0019 0.11 14.0 4.4 1 23 164 187 164 187 0.98

7 10 1.4e-06 7.7e-05 23.8 0.4 1 23 192 214 192 214 0.98

8 10 4.5e-07 2.5e-05 25.4 0.8 1 23 220 242 220 242 0.98

9 10 3.3e-07 1.9e-05 25.8 0.4 1 23 248 271 248 271 0.97

10 10 4.2e-06 0.00024 22.3 0.4 1 23 277 299 277 299 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.38	22	6.7	3.4	1	23	17	39	17	39	0.97
2	10	0.0042	0.24	12.8	0.1	3	23	49	70	47	70	0.90
3	10	0.0014	0.078	14.4	1.1	1	23	75	97	75	97	0.97
4	10	0.09	5.1	8.7	0.9	7	23	111	128	108	128	0.95
5	10	5.5e-06	0.00031	21.9	1.7	1	23	133	155	133	155	0.99
6	10	0.0019	0.11	14.0	4.4	1	23	164	187	164	187	0.98
7	10	1.4e-06	7.7e-05	23.8	0.4	1	23	192	214	192	214	0.98
8	10	4.5e-07	2.5e-05	25.4	0.8	1	23	220	242	220	242	0.98
9	10	3.3e-07	1.9e-05	25.8	0.4	1	23	248	271	248	271	0.97
10	10	4.2e-06	0.00024	22.3	0.4	1	23	277	299	277	299	0.98

Sequence Information

Coding Sequence: ATGAGTTTTAAAGACAAGTGCAAGGAAGCATTAAACAAAGATGGCTCATATAATTGCCAGTTGTGCAACAAACAGGTTTTCGAAACAGAAAAATTCAGGAGTCACATGCACATTCACAAATTACGCGAAATCAATCCCATAATATGTACCGTATGTAATAAAGTGTTTGCAACCATTCGTAGGTTGGAACAGCACAAAATAGAAGCTCACACCGGGATAGAATACAAGTGCGCTAAAtgccaaaaaatttattcaagCCCTTTAAGGTTAAAGAATCATGAAAAATTGCATGAACCCAGTGACTTCGAAGTTTTCTGTATTCTCTGCAACGGAAAGAAGTTTAACAGTAAAACGACATTTAATAGTCATATAAAATCAAAGCATAGTGGTGATGTTTATAAATGTGATGTTTGCAGTAAAGTCTACAGTACCGAGGACTACCTTAAATTGCATAAAAAGACTCATGGAGACAATTatttaaatcccatttttaaatgtgaaatttgtgataaaacatatttaagcAACACTAGCTTTAACCATCATAAAAAAACAGAACATGAAGGCCGAAGATTTGTTTGTTCTGTTTGTGGTAAAATGATGACGAGCAATTCTTCACTAAATACCCACATGAGGATACATAACAAAGAAAAGCCTTTCAATTGTCCGCATTGTGATAAGTCATTTGTGTCAAAGCCAGGACTAAGGGTACATCTACTTACTCATACGAAGGAAAAACCACATGTTTGTGAACTTTGTGGCAAGTCTTATTCACAACGATCTCCTTTGATAATTCACATGAGGACTGTACATGAGAAGGAGAAACCGTTTAAATGCTCCATTTGTAACAAGGGATTTGCCGTTAATACTTTATTGAATTCACATATGAAGGCACATTCGAAAAAGGATGaaggttgctaa
Protein Sequence: MSFKDKCKEALNKDGSYNCQLCNKQVFETEKFRSHMHIHKLREINPIICTVCNKVFATIRRLEQHKIEAHTGIEYKCAKCQKIYSSPLRLKNHEKLHEPSDFEVFCILCNGKKFNSKTTFNSHIKSKHSGDVYKCDVCSKVYSTEDYLKLHKKTHGDNYLNPIFKCEICDKTYLSNTSFNHHKKTEHEGRRFVCSVCGKMMTSNSSLNTHMRIHNKEKPFNCPHCDKSFVSKPGLRVHLLTHTKEKPHVCELCGKSYSQRSPLIIHMRTVHEKEKPFKCSICNKGFAVNTLLNSHMKAHSKKDEGC

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -