Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0018 1.8 9.5 1.0 13 40 26 50 20 53 0.81

2 9 0.1 1.1e+02 3.9 4.0 17 34 58 77 45 80 0.78

3 9 0.02 20 6.2 0.8 14 33 83 99 75 112 0.78

4 9 0.05 51 4.9 0.7 16 29 113 126 105 137 0.79

5 9 0.027 28 5.8 1.8 15 38 140 163 132 167 0.78

6 9 0.00092 0.94 10.5 2.2 6 38 159 187 157 192 0.77

7 9 0.11 1.1e+02 3.8 0.6 5 30 186 211 182 219 0.75

8 9 0.0073 7.5 7.6 1.3 10 40 219 245 208 247 0.76

9 9 0.00026 0.27 12.2 2.1 6 40 243 273 238 276 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0018	1.8	9.5	1.0	13	40	26	50	20	53	0.81
2	9	0.1	1.1e+02	3.9	4.0	17	34	58	77	45	80	0.78
3	9	0.02	20	6.2	0.8	14	33	83	99	75	112	0.78
4	9	0.05	51	4.9	0.7	16	29	113	126	105	137	0.79
5	9	0.027	28	5.8	1.8	15	38	140	163	132	167	0.78
6	9	0.00092	0.94	10.5	2.2	6	38	159	187	157	192	0.77
7	9	0.11	1.1e+02	3.8	0.6	5	30	186	211	182	219	0.75
8	9	0.0073	7.5	7.6	1.3	10	40	219	245	208	247	0.76
9	9	0.00026	0.27	12.2	2.1	6	40	243	273	238	276	0.77

Coding Sequence: ATGACATTTAAGCTCGAGCAAGAAACCATAgatctaaaagatgaagaaaatgaaaatattgtgGAAACTATAGACGACAAAAAACAATATACATGTACCTATTGtgaaagaaaattttctaaAGGAAGCTACTTATTAAAGCACATTAGAGTACACACCGGTGAATTACCATACCAGTGTTCTCATTGTCAGAAACGTTTTAATCATAAGCATTCCTTAAACACACACATTTTAACACACACAGGTGAAAAACAATTCAAATGCGATCATTGTAGTAAAGAGTTTTTCAGAAAAAGCTATTTAGAACAACATATACCAGTGCACACTGGAACTGCTAAATTCGAATGTTCGTACTGTCGGCAACAGTTTAACGAAAAACGGCGTTTAGCACTGCATATTAGAAATCATAAAGGTGAAAAACCCTTTGAGTGTCCTATTTGTTCGAAAAAATTCAGTCAAAAAGTCTCGATACGACATATTAGAACTCACACAAAGGAAAAACCTTTTGAATGCTCATTTTGCGGAAAAAAGTTTGCCAGAAAAAGCCATTTGGAACAACACGTTAGAATTCATACAGGTGAGAAACCGTATGGCTGTCCACACTGTCCGAAAAAGTTTGCTATAAAGGAACACGTGACTTTGCATGTGCGCACCCATACCGCCGAAAAACCGTTTGAATGCCCACATTGTAAGAagagattttctcaaaaaagtcCTTTAACTGAGCACATTAGAATGCACACGAAAGAAACGCCGCACGAATGTTCGTATTGTCAGAAAAAGTTTTCCCGAAAAGCACAGTTTAACCAGCATCTTAGAAAACATACAGGTGAGcaagaaaaattgtaa
Protein Sequence: MTFKLEQETIDLKDEENENIVETIDDKKQYTCTYCERKFSKGSYLLKHIRVHTGELPYQCSHCQKRFNHKHSLNTHILTHTGEKQFKCDHCSKEFFRKSYLEQHIPVHTGTAKFECSYCRQQFNEKRRLALHIRNHKGEKPFECPICSKKFSQKVSIRHIRTHTKEKPFECSFCGKKFARKSHLEQHVRIHTGEKPYGCPHCPKKFAIKEHVTLHVRTHTAEKPFECPHCKKRFSQKSPLTEHIRMHTKETPHECSYCQKKFSRKAQFNQHLRKHTGEQEKL

Sequence clustering based on sequence similarity using MMseqs2