Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0012 0.11 14.1 0.8 5 21 38 54 34 55 0.89

2 7 0.0032 0.28 12.8 0.2 2 21 62 81 61 82 0.92

3 7 0.0003 0.027 16.0 0.7 2 21 89 108 88 113 0.93

4 7 0.089 7.9 8.2 0.3 3 21 129 147 128 148 0.90

5 7 0.00012 0.011 17.3 0.7 2 21 155 174 154 175 0.94

6 7 6.7e-06 0.00059 21.2 0.3 2 20 182 200 181 202 0.93

7 7 0.00069 0.062 14.9 0.8 2 21 209 228 208 229 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0012	0.11	14.1	0.8	5	21	38	54	34	55	0.89
2	7	0.0032	0.28	12.8	0.2	2	21	62	81	61	82	0.92
3	7	0.0003	0.027	16.0	0.7	2	21	89	108	88	113	0.93
4	7	0.089	7.9	8.2	0.3	3	21	129	147	128	148	0.90
5	7	0.00012	0.011	17.3	0.7	2	21	155	174	154	175	0.94
6	7	6.7e-06	0.00059	21.2	0.3	2	20	182	200	181	202	0.93
7	7	0.00069	0.062	14.9	0.8	2	21	209	228	208	229	0.93

Coding Sequence: ATGGATTTGCGTTATGGGGAAAAAAGGCGTTACGTTGTGCGAAATATCCAGTACTTCTCGGTGGTCGTGACACAGAAACCCTCGAATCTTGCTGACAAGCTGAATTGCATTGTCTGCCTGAAGTCGTTCAAGCACAAGGCTGACTTGCAAAGGCACGTCAGGCACGAGTGTGGAAAACGGCTGTCATGTACTTCTTGCCCGAAAGAGTTTCGAACGATTGCCTCACTCAACAGTCATGCAAAACACGAGTGTGGCAAGGATTTGTCGTGCTTGAAGTGTAATAAAAGGTTCAGTTCGAAGAATGGCATGAAGGTACATCTCCGAGGTATCTCGGATCACCTGCCTCTTGCTGTAGATTGCCAGTTGACTGCTGATCGCTGGCTTTGTCCGACTTGCAACTCCAGCTTCAAGTACAAGGGCATGCTGAACTTCCATTTGAAACACGAGTGCGGTCGGGATTTACGGTGCAAAACTTGCGACAAGTCATACAAGGCCATCTCCCACCTAAACGCTCACATCAAATACGAGTGTGGGAAGTTGCTGCGGTGTCCGCGATGTGAGAAGAGCTTCTCCACACGTACAAACCTCATATCTCATATATCCTATGTTTGTGGCAAAGACTTGCGGTGCAAGAAATGCGAAAAGGATTTCAAGACAGTGGCGGGTTTGAAGAAACATAATCGAAATGGCTGTCTCAAAGTTGGTCGTATTGCTCAGTCCAAATCAAGCACTCCGTAA
Protein Sequence: MDLRYGEKRRYVVRNIQYFSVVVTQKPSNLADKLNCIVCLKSFKHKADLQRHVRHECGKRLSCTSCPKEFRTIASLNSHAKHECGKDLSCLKCNKRFSSKNGMKVHLRGISDHLPLAVDCQLTADRWLCPTCNSSFKYKGMLNFHLKHECGRDLRCKTCDKSYKAISHLNAHIKYECGKLLRCPRCEKSFSTRTNLISHISYVCGKDLRCKKCEKDFKTVAGLKKHNRNGCLKVGRIAQSKSSTP

Sequence clustering based on sequence similarity using MMseqs2