Basic Information

Insect: Bombus polaris
Gene Symbol: lola
Assembly: GCA_014737335.1
Location: JACXIO010000030.1:930479-933977[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00014 0.014 16.1 1.7 1 20 59 78 59 80 0.95

2 8 0.0045 0.46 11.3 5.5 1 23 88 111 88 111 0.98

3 8 0.006 0.61 10.9 0.5 1 21 150 170 150 171 0.96

4 8 6.3 6.5e+02 1.4 1.3 1 6 179 184 179 187 0.87

5 8 0.0015 0.16 12.8 0.1 1 21 215 237 215 238 0.95

6 8 0.0062 0.63 10.9 2.1 1 20 246 265 246 269 0.93

7 8 0.19 19 6.2 0.1 1 21 293 315 293 316 0.93

8 8 1.9e-05 0.0019 18.8 2.2 1 23 324 347 324 347 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00014	0.014	16.1	1.7	1	20	59	78	59	80	0.95
2	8	0.0045	0.46	11.3	5.5	1	23	88	111	88	111	0.98
3	8	0.006	0.61	10.9	0.5	1	21	150	170	150	171	0.96
4	8	6.3	6.5e+02	1.4	1.3	1	6	179	184	179	187	0.87
5	8	0.0015	0.16	12.8	0.1	1	21	215	237	215	238	0.95
6	8	0.0062	0.63	10.9	2.1	1	20	246	265	246	269	0.93
7	8	0.19	19	6.2	0.1	1	21	293	315	293	316	0.93
8	8	1.9e-05	0.0019	18.8	2.2	1	23	324	347	324	347	0.98

Sequence Information

Coding Sequence: ATGTTTTGGATAGTACATCGCGTGTGGCAGCTTCTACCGGTTTATACTACGGGCCCGTTCAGCGTGTTCGGGATCAACGTTGGTATCGAAGATGACCAAGGCCAAAGTATCGGCAAACTCTGGTCCCGATCGTCGAACCAAACCGATTTAGACAATAACTTTAAGACGAAGAGGTTTCCCTGTCCGAACTGTACCTGTGCCTACAGCCAGAAATACTCGTTGAATCGGCACCTGACCTACGAGTGTGGCCAAGAACCCCGGTTTAAATGTCCCCACTGCGAATATCGATGCAAGAAATCGGCCAACATTTATGAGCACGTGAGAAGAAGACACAAAAACTGTCAGGTATACGCGATCGACGTTCTAAAGATCGCTCATTCTCGATATCACGCGAACGCTTGCTACAAGAAGCGACGAGTACGGTTCAACGACGCGACTTACAAGCAATATCCCTGCCCTAATTGTCCGAGCGTTTTCGTTTGGAAATGCACGCTGAAGAGACATTTGCGTAACGAGTGTGGACAAGAACCGCGCTTCAAGTGTCCCTACTGCGTGTACCGTGATTCCGAGCAAAGTTGGTGGCCGTACAGGGAAGTTGGTAGATCGACGAAATGCAGATCGTCGAAACTGCGCAACGCGATTTACATTTGTCCAAGTCCTAATTGCGCCAAATCGTTTAATTGGAAGGGAAACTTGAACAGACATCTGAGATACGAGTGCGGCGTGCAGCCACGATTCAAGTGTCCGTATTGCGAGTATCGTTGTAAAGTTAAAGGAGACGTGAGCAAGCACATACCAAGAAGACATCACGGGCACAATGGATCTACGTCATTGAGGGGTCGCCAACGCACGAATTGCCTCGTGAAAGCTAGCAAGTACGCCTGCCCAAATCCCAACTGTCGAAGCGTATTCGCTTGGAAGAGAAACTTGACCAGTCATTTACGCTATCAATGCGGCCGACAACCGAGATTCAAGTGTCCTTATTGCGACTACATGTGCAAAGTTAAGGCTGATATACGCAAGCACATCAGGATCAAGCACAAGAACAGCGACGTCTATGTGATCGATATTTGTCAAGCGTGGGAAATTGTTAGATGA
Protein Sequence: MFWIVHRVWQLLPVYTTGPFSVFGINVGIEDDQGQSIGKLWSRSSNQTDLDNNFKTKRFPCPNCTCAYSQKYSLNRHLTYECGQEPRFKCPHCEYRCKKSANIYEHVRRRHKNCQVYAIDVLKIAHSRYHANACYKKRRVRFNDATYKQYPCPNCPSVFVWKCTLKRHLRNECGQEPRFKCPYCVYRDSEQSWWPYREVGRSTKCRSSKLRNAIYICPSPNCAKSFNWKGNLNRHLRYECGVQPRFKCPYCEYRCKVKGDVSKHIPRRHHGHNGSTSLRGRQRTNCLVKASKYACPNPNCRSVFAWKRNLTSHLRYQCGRQPRFKCPYCDYMCKVKADIRKHIRIKHKNSDVYVIDICQAWEIVR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00228225;
90% Identity: iTF_00228225;
80% Identity: -