Basic Information

Transcription Factor Domain

TF Family: TF_bZIP
Domain: bZIP domain
PFAM: AnimalTFDB
TF Group: Basic Domians group
Description: bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.00038 0.3 10.9 0.8 32 61 3 32 1 35 0.85

2 3 0.00021 0.17 11.7 2.4 21 54 34 67 33 68 0.94

3 3 6.9e-07 0.00054 19.7 8.4 24 60 58 94 57 98 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.00038	0.3	10.9	0.8	32	61	3	32	1	35	0.85
2	3	0.00021	0.17	11.7	2.4	21	54	34	67	33	68	0.94
3	3	6.9e-07	0.00054	19.7	8.4	24	60	58	94	57	98	0.92

Coding Sequence: ATGATAAACGaagcgaataaattaaaagccGATTTggataaattgaaaagcgaTTATAGCGAGTTGCGGTCGGAATTAGGTAAACTAAGGGACGAGAAAAATAGACGCAAAGAACGCGATGCTGCATTAGCCACGGATCTGGACGAATTGAAGAAAGGGAATGGCGAGTTAAAAGATGGGAATGAGAAACTGGAAAGCCAGTTATTCGATTGCCAAGAGGAGAAGGAAAGGCTACGCAAGGAATTGCGAAAGCTGAGGAGAGAAAATGCCAAATTGAAAGAAGATATGATGACTACCGTTTCAATTTGTTtggaattgaaattataa
Protein Sequence: MINEANKLKADLDKLKSDYSELRSELGKLRDEKNRRKERDAALATDLDELKKGNGELKDGNEKLESQLFDCQEEKERLRKELRKLRRENAKLKEDMMTTVSICLELKL

Sequence clustering based on sequence similarity using MMseqs2