Basic Information

Insect: Biston betularia
Gene Symbol: -
Assembly: GCA_905404145.1
Location: FR989862.1:7586421-7589006[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.4e-05 0.0011 19.9 2.1 1 23 2 25 2 25 0.98

2 7 9.6 7.7e+02 1.5 1.2 5 23 123 142 110 142 0.85

3 7 0.21 16 6.8 0.4 1 23 181 204 181 204 0.93

4 7 3e-07 2.4e-05 25.1 1.3 1 23 210 232 210 232 0.98

5 7 2.5e-06 0.0002 22.2 0.4 1 23 238 260 238 260 0.97

6 7 7.2e-08 5.7e-06 27.1 3.6 1 23 266 288 266 288 0.99

7 7 2.8e-06 0.00023 22.1 4.1 1 23 294 316 294 316 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.4e-05	0.0011	19.9	2.1	1	23	2	25	2	25	0.98
2	7	9.6	7.7e+02	1.5	1.2	5	23	123	142	110	142	0.85
3	7	0.21	16	6.8	0.4	1	23	181	204	181	204	0.93
4	7	3e-07	2.4e-05	25.1	1.3	1	23	210	232	210	232	0.98
5	7	2.5e-06	0.0002	22.2	0.4	1	23	238	260	238	260	0.97
6	7	7.2e-08	5.7e-06	27.1	3.6	1	23	266	288	266	288	0.99
7	7	2.8e-06	0.00023	22.1	4.1	1	23	294	316	294	316	0.98

Sequence Information

Coding Sequence: ATGTTTGTTTGTCGTATGTGCAAGAAGACGTTTTATAATGCAAACGCGCTGAAGAATCATCGAAACACCCAACACGACGGCGGTGAAGTTTCTTGCAGTGAGACAGAATACCACATTCCTACGTATTACGACGATCAGAACTACATCAGTGGTTTCAAGTTCATACCAAGTCCAAACGCTGATACTTCGTCCGATACTGTTCATGACGGCCTTACAACGCGAATGTTCTCACAGAGCACCTCTTATATGATAGTGAAGGTAGACGGTGGAATAGGAGAGGCCACAGCGCTCGATGATGGGATAAAGCCGATCGATTCGAGGGGTCCTTTCACATGTACTTTTCCGATGCCGCTGCGACCGGACATGCAATGCAGGCAAATATTTTTCAACTGCTGCGATTATTCACTACACTACCGTGAAGAGCACACAAAGCGTAGGAAAGCCGCGCTACGATGCCAAGTATGCGAGAAAAGGCTCGACAGAGATTTCAATCCTAATGACTCACTTGCAGCCCAATTGCAAACCACCAACCAAGTGACGTTCTCTTGTCGCATGTGCGGGCAGATATTCCTAGATAGCTTTCAATATGACGAGCATAATCGCGTCATTCATGCGAAAATGAAGCCCCATCAGTGCCCACTATGCGCAAAACGGTTTACCCAACAAGGAGGGTTGCAACAGCACATGAGAATGCACTCTGGAATCAGACCGTTCGCTTGTACGTTTTGCCCGAAAGCGTTTACGCAAAAAGCAGGCTTGGACCAACATCTACGCACGCATACTAAAGTGAAGCCTTTTAGATGTGTTATCTGTAGCAAGAGTTTCTCCCAATCCGTACATCTTAGACAGCACATGCGCACACATACGAATATTCAGCCGTTTGAGTGCTCAGTTTGTGGGCGGAAGTTCAAACAGAGTAGCCATTTGAATTTTCACATGAGGTCTCACATAACAGATGGAACTATGCCTATGGAGAGCTACGCACAAGTCATTCAAGAGCAGAATCATATGGAATTTCTGAACTTATCTAATCTACAGCCGATTCAGGATGGCGAAACGTTGTACTATGTAGCAGAAATAGGACCTTCTATGCGAACCAATAACTATGGTATCCCGGAAATTAATTTTCGCATGAGTAGATTTTAA
Protein Sequence: MFVCRMCKKTFYNANALKNHRNTQHDGGEVSCSETEYHIPTYYDDQNYISGFKFIPSPNADTSSDTVHDGLTTRMFSQSTSYMIVKVDGGIGEATALDDGIKPIDSRGPFTCTFPMPLRPDMQCRQIFFNCCDYSLHYREEHTKRRKAALRCQVCEKRLDRDFNPNDSLAAQLQTTNQVTFSCRMCGQIFLDSFQYDEHNRVIHAKMKPHQCPLCAKRFTQQGGLQQHMRMHSGIRPFACTFCPKAFTQKAGLDQHLRTHTKVKPFRCVICSKSFSQSVHLRQHMRTHTNIQPFECSVCGRKFKQSSHLNFHMRSHITDGTMPMESYAQVIQEQNHMEFLNLSNLQPIQDGETLYYVAEIGPSMRTNNYGIPEINFRMSRF

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00143317;
90% Identity: iTF_00034100;
80% Identity: -