Basic Information

Insect: Beris morrisii
Gene Symbol: ZBTB41
Assembly: GCA_951812415.1
Location: OX638312.1:91068009-91068833[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.16 19 6.9 3.0 2 23 32 53 31 53 0.97

2 8 4.5e-06 0.00055 21.2 2.8 1 23 59 82 59 82 0.98

3 8 5.3e-06 0.00065 20.9 0.5 2 23 94 115 93 115 0.97

4 8 6.6e-08 8e-06 26.9 1.3 1 23 121 144 121 144 0.97

5 8 0.018 2.1 9.9 3.2 1 23 154 176 154 176 0.97

6 8 5.5e-06 0.00066 20.9 3.1 1 23 182 205 182 205 0.97

7 8 0.00023 0.028 15.8 0.1 2 23 216 237 215 237 0.97

8 8 9e-05 0.011 17.1 3.7 1 20 243 262 243 264 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.16	19	6.9	3.0	2	23	32	53	31	53	0.97
2	8	4.5e-06	0.00055	21.2	2.8	1	23	59	82	59	82	0.98
3	8	5.3e-06	0.00065	20.9	0.5	2	23	94	115	93	115	0.97
4	8	6.6e-08	8e-06	26.9	1.3	1	23	121	144	121	144	0.97
5	8	0.018	2.1	9.9	3.2	1	23	154	176	154	176	0.97
6	8	5.5e-06	0.00066	20.9	3.1	1	23	182	205	182	205	0.97
7	8	0.00023	0.028	15.8	0.1	2	23	216	237	215	237	0.97
8	8	9e-05	0.011	17.1	3.7	1	20	243	262	243	264	0.95

Sequence Information

Coding Sequence: ATGGCAACAGCAGTGTCAAGAAGACCGGTTCCGCCTGTTCCAGTAAATGCTGCACAACCACTTGTACCGCCTCGTAAACGAAAACAAACTCTTCAATGTTCGGTTTGTTCGATAATTTGTCCGTCGAAATGCCGATATGACGAACATATGCGAATGCACACGGGCATTAAACCGTACAAGTGCGATATTTGTTCGCAATCATTTCGATTCAAGTTCGGCTTAAAGAATCACGTCCGAACGAAACATGCGATACTCGATTCGGACGAAAAATCCGAACTGCAGTGTTCGGaatgtttgaaaattttcgGACATAAAAGCGGTCTATTAGCACATATGCGCGTACATACCGGCGATTTACCGTTTAAATGTGACATATGCCCGAAATCATTTCGATATAAAAGCAATTTAATAACGCACAATCGTATCAATCACACAGTAGATGCAGGTAATAAAAACGAATATACGTGCGAAATATGTTCGAAAATTTTCACCTGTATAAGTAAATTGCTCTATCATTCGCGATCGCATACCAAAGAGAAACCatttaaatgtgaaatttgttcCAAAACTTTTCGATATACGAACAATTTAAAGGTTCATAAGCGTGAAAAGCACAACGATCAATCGGCAAGTACAAATAATTTACAATGTGAAATATGCTCGATAATTTTGTCATCTCCAAGTAAATTGGTTTATCATATGAAATCACATTGCGACGAGAAACCATTTAAATGCGATGCGTGTGCAAAAACCTTTCGACATAAGCACAATTTGAAGAGGCATAAATTATTAAATCCGGAATTTAAATGTGCGGAAAAAAGTTGA
Protein Sequence: MATAVSRRPVPPVPVNAAQPLVPPRKRKQTLQCSVCSIICPSKCRYDEHMRMHTGIKPYKCDICSQSFRFKFGLKNHVRTKHAILDSDEKSELQCSECLKIFGHKSGLLAHMRVHTGDLPFKCDICPKSFRYKSNLITHNRINHTVDAGNKNEYTCEICSKIFTCISKLLYHSRSHTKEKPFKCEICSKTFRYTNNLKVHKREKHNDQSASTNNLQCEICSIILSSPSKLVYHMKSHCDEKPFKCDACAKTFRHKHNLKRHKLLNPEFKCAEKS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -