Belo031877.1
Basic Information
- Insect
- Baccha elongata
- Gene Symbol
- Cebpg
- Assembly
- GCA_951217065.1
- Location
- OX578272.1:143996183-143996702[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.7e-09 8.1e-06 27.4 10.8 4 62 25 83 23 85 0.96 2 2 3.6 1.1e+04 -1.8 0.1 40 48 92 100 88 102 0.77
Sequence Information
- Coding Sequence
- ATGCCGGCCAAAAGAAGAACTGCAAAATCCATTGCATCGAGTGGTAATTCCGATGATCCAGAGGGTGGTGATGAATATCGCCAGAAGAGGATGAGAAACAAtgagGCTGTCAAAAAATCacgagaaaaaacaaataaaactgcaAACGATCGGAAGCAACGTGTCGAAGCATTAAAAACTGAGAATATTCGACTAGAAACCCAAATTAAAGAAACTGAAAAGAATATTGAGACACTCAAAAGTTTACTGCTTTCAAATGCCAAAAGCAATATGGAAAAAGAGAAATTAATCAAGGAGATACTTGCTGAAACCAGCGATAGCGAATGA
- Protein Sequence
- MPAKRRTAKSIASSGNSDDPEGGDEYRQKRMRNNEAVKKSREKTNKTANDRKQRVEALKTENIRLETQIKETEKNIETLKSLLLSNAKSNMEKEKLIKEILAETSDSE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00309976;
- 90% Identity
- iTF_00664611;
- 80% Identity
- -