Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.19 6.8e+03 -1.8 0.4 6 10 7 11 6 13 0.72

2 5 6.7e-09 0.00025 22.0 11.7 1 19 17 35 17 35 0.93

3 5 1 3.7e+04 -5.0 1.8 15 15 44 44 42 45 0.46

4 5 0.012 4.5e+02 2.0 0.5 5 10 66 71 66 73 0.89

5 5 2e-06 0.074 14.1 13.6 4 18 84 98 77 99 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.19	6.8e+03	-1.8	0.4	6	10	7	11	6	13	0.72
2	5	6.7e-09	0.00025	22.0	11.7	1	19	17	35	17	35	0.93
3	5	1	3.7e+04	-5.0	1.8	15	15	44	44	42	45	0.46
4	5	0.012	4.5e+02	2.0	0.5	5	10	66	71	66	73	0.89
5	5	2e-06	0.074	14.1	13.6	4	18	84	98	77	99	0.86

Coding Sequence: ATGGTGGTATATTACAGCTGTGGAAGtctgtgtgaaaaaaaattgtcttgtgAAAATCACTTATGCCAGAAAGTGTGTCATGTTGGTCAATGTGACCCGTGTACAGCTTTATCTGTTAATAGATGTCCTTGTGGAAAACGGCCATTGACAGAAGATGAACTTAGCAACCGTACATTATGCATACAACCGGTACCCACATGTGACCAACCATGTGGAAAACCTCTAGAATGTGGTCCCCCagaaaatCCTCATCGCTGTGAACAAAATTGTCATGAAGGTCCATGTGTGCGCTGTGAACTTAAAACCAAATATGTGTGTAAATGCGGTAGTAGATCCaaggaaataaaatgtaattctgTTACCAAGATAttctttaaacaataa
Protein Sequence: MVVYYSCGSLCEKKLSCENHLCQKVCHVGQCDPCTALSVNRCPCGKRPLTEDELSNRTLCIQPVPTCDQPCGKPLECGPPENPHRCEQNCHEGPCVRCELKTKYVCKCGSRSKEIKCNSVTKIFFKQ

Sequence clustering based on sequence similarity using MMseqs2