Basic Information

Transcription Factor Domain

TF Family: TF_bZIP
Domain: bZIP domain
PFAM: AnimalTFDB
TF Group: Basic Domians group
Description: bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 5.4 8.6e+03 -2.4 0.3 44 44 25 25 15 33 0.50

2 4 8.8 1.4e+04 -3.1 0.1 8 12 29 33 23 36 0.70

3 4 3e-05 0.047 14.4 0.6 27 64 40 77 37 78 0.86

4 4 1e-06 0.0017 19.1 2.5 26 58 74 106 67 111 0.53

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	5.4	8.6e+03	-2.4	0.3	44	44	25	25	15	33	0.50
2	4	8.8	1.4e+04	-3.1	0.1	8	12	29	33	23	36	0.70
3	4	3e-05	0.047	14.4	0.6	27	64	40	77	37	78	0.86
4	4	1e-06	0.0017	19.1	2.5	26	58	74	106	67	111	0.53

Coding Sequence: ATGTCGATGGCAAAGTGTACTGCTCAAGAGGGAATAGTAAGTAACAGGCATAATAAGGAGGAGCTAGAATCCTTGGCGAAACCAAGGAAGTTGAGAAATGGGATCTACTTGGCTCAAGAGAATGTCTACCTAAGTCAAGTGGAGGATCTAACGAATCAAGTAGAGGATCTAACAAGTCAAGTAGAGGATGTAACGGGTCAAGTAGAGGATCTAACGAGTCAAGTAGAGGATCTAACGAGTCAAGTAGAGGATCTAATGAGTCAAGTAGAGGATCTAACGAGTCAAGTAGAGGATCTAACACGTCAAGTAGAGGATCTACTTGAGTCAAGTCGAGGATCTACCTGA
Protein Sequence: MSMAKCTAQEGIVSNRHNKEELESLAKPRKLRNGIYLAQENVYLSQVEDLTNQVEDLTSQVEDVTGQVEDLTSQVEDLTSQVEDLMSQVEDLTSQVEDLTRQVEDLLESSRGST

Sequence clustering based on sequence similarity using MMseqs2