Aleu004010.1
Basic Information
- Insect
- Argyra leucocephala
- Gene Symbol
- -
- Assembly
- GCA_963942445.1
- Location
- OZ012677.1:113718458-113718781[+]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.5e-11 1.8e-08 35.0 0.0 1 40 7 45 7 49 0.94
Sequence Information
- Coding Sequence
- atgtCTATAGGCGGCTGGACTCCTGAAGAAATGAAAAAGGCTCTAAATGTAATAAATGATGGTGTACCAATTAGCAAAGCTGCAAGACTTTACAATATACCCGAATCGACGATTCGCAAAGACAAAAAGAGGCATTGTTATGAAACCACTCCAGCCTTAGGAAGAAGGTCTTTATTAAATATGGAGCAAGAAAAAGAGTTATTGCCATTTGATTACGTTATTCCAAATGTTTCTCGCACCAACAAATGTTACTCCAACCAATTGAATTTAGAAATCTCGCATTTGATTACGCAGAATCAAATAAGATTCCACATAATTTTTTAA
- Protein Sequence
- MSIGGWTPEEMKKALNVINDGVPISKAARLYNIPESTIRKDKKRHCYETTPALGRRSLLNMEQEKELLPFDYVIPNVSRTNKCYSNQLNLEISHLITQNQIRFHIIF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -