Basic Information

Insect: Archips xylosteana
Gene Symbol: -
Assembly: GCA_947563465.1
Location: OX387352.1:12479494-12480633[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.065 4.7 8.6 0.0 2 23 57 79 57 79 0.90

2 6 0.00017 0.012 16.7 0.9 1 23 90 113 90 113 0.94

3 6 0.00019 0.014 16.6 2.7 1 23 123 145 123 145 0.97

4 6 2.2e-06 0.00016 22.7 2.1 1 23 296 318 296 318 0.97

5 6 2.7e-06 0.0002 22.4 0.2 1 23 324 346 324 346 0.98

6 6 1.7e-05 0.0012 19.9 3.3 1 23 352 374 352 374 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.065	4.7	8.6	0.0	2	23	57	79	57	79	0.90
2	6	0.00017	0.012	16.7	0.9	1	23	90	113	90	113	0.94
3	6	0.00019	0.014	16.6	2.7	1	23	123	145	123	145	0.97
4	6	2.2e-06	0.00016	22.7	2.1	1	23	296	318	296	318	0.97
5	6	2.7e-06	0.0002	22.4	0.2	1	23	324	346	324	346	0.98
6	6	1.7e-05	0.0012	19.9	3.3	1	23	352	374	352	374	0.98

Sequence Information

Coding Sequence: ATGACATGCGCTTCGCCGAGCATCCCCAGCCCCATCCCGCCGCGAAGTCCTACCGCCATGCCGCTCTGGTCGCCCCTGCTGGCATTGCAGGCGTGCCGATTGCGAAGGTACCTCAGCGATGACTGTATGTCCTATCAAAATAGACATTTGCTCCACTCTGAAAGGCGGCGCTGCGGTGTCTGCCTCGCCTCCTTCCCTTCCGCTTGGCTCCTGGAGCGCCACGCCGCTTTGCAACATGCCTCGCAGACTTCTTGCGACGACAAACCTTTCGTCTGCGAACAATGCGGGCAGAGCTACAGATATAGATCTGCTTATGTCAAACACCGAGAGCAAAATCATCGAGCCAGACTACCTGCTGACAAACTGTTTACCTGTGACGTCTGCGGTATGCAGTTCCGCTATCTGAAATCCTTCAAAAAACATCGCCTCAATCACACCTTGGAACGTCTCCATACGAAAAACACTGATCCAACTGACAGTATCGATCAGGTTTCTAGTACAAACGAGGCTTTGTTGGGCCGCTGTGGTGAGATGGACCTTTCAATCAAAAAGAAAAGCAGAGCTGAGACCACCAGGAGTCCTCCAATTGAAGTTCATGATGAACAAGACAGTACTGTCGATTCGAACGGTCCAACGGACTCTATAGTAACAGTTGACGACTCGACTGACTGTAGAAACTCGAGCGCTGAAAGTGAGACCAGAAGAGAGGATACTCCCGCCGAAGAGAGAAGGCGCGCGCCGGTGTCGTTCGCAAGTGTTAGTTCGATTGCAGACAGTTCTGAAAGCGAGTCTCGCCCTGACAGCAAAAATGACAGTGCGAGTTCACATTCTGGTATCTTGGGGTTCTTGCAAAACGACGATAGGCAAAGAGACAGGGAGAGGAGGTTCGCATGCCCGTTTTGCGGGAAATGCGTTAGGTCCAAAGAAAATTTGAAGTTGCACGTCAGGAAGCATACTGGGGAACGTCCGTTCGTGTGCTTGTTTTGTGGACGAGCGTTCGGGGGCAAGAGCGATCTGACTCGTCACTTGCGCATCCACACCGGAGAGCGACCCTACCACTGCGAGGCGTGCGGCAAGTGCTTCGCCCGCGCCGACTACCTCTCGAAGCACCTCACGACGCACGTGCACAACGCGCGCTGA
Protein Sequence: MTCASPSIPSPIPPRSPTAMPLWSPLLALQACRLRRYLSDDCMSYQNRHLLHSERRRCGVCLASFPSAWLLERHAALQHASQTSCDDKPFVCEQCGQSYRYRSAYVKHREQNHRARLPADKLFTCDVCGMQFRYLKSFKKHRLNHTLERLHTKNTDPTDSIDQVSSTNEALLGRCGEMDLSIKKKSRAETTRSPPIEVHDEQDSTVDSNGPTDSIVTVDDSTDCRNSSAESETRREDTPAEERRRAPVSFASVSSIADSSESESRPDSKNDSASSHSGILGFLQNDDRQRDRERRFACPFCGKCVRSKENLKLHVRKHTGERPFVCLFCGRAFGGKSDLTRHLRIHTGERPYHCEACGKCFARADYLSKHLTTHVHNAR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00055956;
90% Identity: iTF_00149830;
80% Identity: iTF_00155645;