Basic Information

Insect: Aquatica leii
Gene Symbol: -
Assembly: GCA_035610365.1
Location: CM069432.1:73592451-73593442[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 9.3e-07 0.00022 24.1 0.5 3 23 16 37 14 37 0.96

2 9 2.3e-05 0.0055 19.7 1.1 1 23 58 80 58 80 0.99

3 9 0.0061 1.5 12.1 4.0 1 23 86 108 86 108 0.97

4 9 0.0024 0.59 13.3 0.6 3 23 122 142 121 142 0.96

5 9 0.00047 0.11 15.6 4.2 1 23 147 169 147 169 0.97

6 9 2e-07 4.7e-05 26.2 2.4 1 23 175 197 175 197 0.98

7 9 4.5e-06 0.0011 21.9 1.0 1 23 203 225 203 225 0.96

8 9 2.9e-07 6.9e-05 25.7 0.2 1 23 231 253 231 253 0.98

9 9 5e-05 0.012 18.6 2.0 1 23 259 282 259 282 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	9.3e-07	0.00022	24.1	0.5	3	23	16	37	14	37	0.96
2	9	2.3e-05	0.0055	19.7	1.1	1	23	58	80	58	80	0.99
3	9	0.0061	1.5	12.1	4.0	1	23	86	108	86	108	0.97
4	9	0.0024	0.59	13.3	0.6	3	23	122	142	121	142	0.96
5	9	0.00047	0.11	15.6	4.2	1	23	147	169	147	169	0.97
6	9	2e-07	4.7e-05	26.2	2.4	1	23	175	197	175	197	0.98
7	9	4.5e-06	0.0011	21.9	1.0	1	23	203	225	203	225	0.96
8	9	2.9e-07	6.9e-05	25.7	0.2	1	23	231	253	231	253	0.98
9	9	5e-05	0.012	18.6	2.0	1	23	259	282	259	282	0.95

Sequence Information

Coding Sequence: ATGCAAACGCATAAACAAATTCATAACGGAACAGTACAAATTATTTGTGAATATTGTGGAAAGCCATTTActtctaaaaacaattatagGAGTCATTTGAATAAGATTCACAAAGATTCTGAAAATTCCGAAGGTTTAACTAAATTAGATGGTACCAGTACCAATGAAATATACAAATGCAATAGCTGTGAAAGAGTTTTCACCAAATTGCAATCATTAAATCAACATGCGCGAGTGCATGATGAAAATGGAAACTTCACTTGTGATatttgtaaaacagtttttcgtATAAGTTTCTGTTTCAAAGTTCATATGTTCCTGCACGAAGTACAAATGTTAAAATCGGACAGTGACGCACCTGCTTGTAAATTCTGCTTTAATACGTATTCAAATAAGAGCGACTTGGAACTGCACTTACTTGGCCATATTGAAAAGCCATTTCAATGCATACATTGCGGCAAATCTTTCACGAGAAAAATTAGATTGAGTTACCATTTGCGTCAGCACTCAGaagaaaGACCTTTTCCTTGTAAAGAATGTGGCAAGACTTTTAGGAATCCTACCACGTTACATCAACATCAAAAAATTCACAGTGGAAGAAAACCGTATTTATGTAAGATTTGTTTAAAGGCTTTTACACAACAACAACAGTTATCCAGTCACATGCTTACTCATACCGGAGAAAAGAAATTTGTATGTCAGTATTGCGGACGGGCTTTTGCTTTGAATGGTAATTTAACTGTTCATATAAGAAGACACACAGGTGACACCCCGTTTTATTGCGAGGTTTGTGGAAAGGGTTTTCATGATAGCAGCAGTAGAAAGAAGCATATGATTtggaaacataaaaatgaattacctAATAACGCTATAAAAACAGAAACTGTATAA
Protein Sequence: MQTHKQIHNGTVQIICEYCGKPFTSKNNYRSHLNKIHKDSENSEGLTKLDGTSTNEIYKCNSCERVFTKLQSLNQHARVHDENGNFTCDICKTVFRISFCFKVHMFLHEVQMLKSDSDAPACKFCFNTYSNKSDLELHLLGHIEKPFQCIHCGKSFTRKIRLSYHLRQHSEERPFPCKECGKTFRNPTTLHQHQKIHSGRKPYLCKICLKAFTQQQQLSSHMLTHTGEKKFVCQYCGRAFALNGNLTVHIRRHTGDTPFYCEVCGKGFHDSSSRKKHMIWKHKNELPNNAIKTETV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -