Atae023513.1
Basic Information
- Insect
- Aproaerema taeniolella
- Gene Symbol
- CrebB
- Assembly
- GCA_949987775.1
- Location
- OX465252.1:14004286-14004717[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.5e-15 2.6e-12 48.0 16.8 3 53 53 103 51 109 0.96
Sequence Information
- Coding Sequence
- ATGTTGTCGATAGTGATTCCAGCGGGCGCGCTGCAATCGGAGAGCGGGCTGCACACGCTGGCGGTGACGGGCTCGGCGGGCGGCGGCGCCATCGTGCAGTACGCCAACCAGGAGGCGCAGTTCTATGTGCCCGGTCCGATGCTAGAAGATCAGACACGCAAACGAGAACTCAGATTGCTTAAAAATCGAGAAGCCGCGAGAGAATGTCGTCGAAAGAAGAAGGAATACATCAAGTGTCTCGAGAACAGAGTTGCAGTGCTGGAAAATCAAAACAAAGCCTTGATAGAGgaattgaaaactctgaaagaACTTTATTGCCAGCAAAAAACAGAATGA
- Protein Sequence
- MLSIVIPAGALQSESGLHTLAVTGSAGGGAIVQYANQEAQFYVPGPMLEDQTRKRELRLLKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKTLKELYCQQKTE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01208947;
- 90% Identity
- iTF_00034451;
- 80% Identity
- -