Basic Information

Transcription Factor Domain

TF Family: zf-GATA
Domain: zf-GATA domain
PFAM: PF00320
TF Group: Zinc-Coordinating Group
Description: This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0083 26 5.1 0.0 3 14 18 29 17 36 0.86

2 5 0.12 3.8e+02 1.4 0.0 3 12 40 49 39 57 0.86

3 5 0.01 32 4.8 0.0 3 14 62 73 61 81 0.91

4 5 0.0017 5.3 7.4 0.0 2 14 83 95 83 102 0.87

5 5 0.0083 26 5.1 0.0 3 14 106 117 105 124 0.86

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0083	26	5.1	3	14	18	29	17	36	0.86
2	5	0.12	3.8e+02	1.4	3	12	40	49	39	57	0.86
3	5	0.01	32	4.8	3	14	62	73	61	81	0.91
4	5	0.0017	5.3	7.4	2	14	83	95	83	102	0.87
5	5	0.0083	26	5.1	3	14	106	117	105	124	0.86

Coding Sequence: ATGTTCTCTCAAGGAGGACACTTCTACGATACTGCTAAGACACGTCTACAAGACTGCTACGACACGTCTACGACACTGCTACGACACTTCTACGATTCTGCTAAGACACGTCTACAAGACTGCTACGACACGTCTACGACACTGCTACAACACTTCTACGATTCTGCTAAGACACGTCTACAAGACTGCTACGACACGTCTACGACACTGCTACGACACTTCTACGGTTCTGCTAAGACACGTCTACAACACTGCTACGACACGTCTACGACACTGCTACGACACTTCTACGATTCTGCTAAGACACGTCTACAAGACTGCTACGACACGTCTACGACACTGCTACGACACTTCTACGATTCTGCTAAGACACGTCTACGACACTGCTAG
Protein Sequence: MFSQGGHFYDTAKTRLQDCYDTSTTLLRHFYDSAKTRLQDCYDTSTTLLQHFYDSAKTRLQDCYDTSTTLLRHFYGSAKTRLQHCYDTSTTLLRHFYDSAKTRLQDCYDTSTTLLRHFYDSAKTRLRHC

Sequence clustering based on sequence similarity using MMseqs2