Abis008512.1
Basic Information
- Insect
- Apomyelois bistriatella
- Gene Symbol
- -
- Assembly
- GCA_947044225.1
- Location
- CAMRHB010000027.1:2822532-2829079[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 8 0.00088 0.059 14.3 0.1 1 23 48 71 48 71 0.95 2 8 0.0027 0.18 12.7 0.2 2 20 92 110 92 116 0.92 3 8 0.00053 0.036 14.9 0.5 3 23 126 147 126 147 0.95 4 8 0.14 9.4 7.3 0.1 3 23 168 189 167 189 0.95 5 8 1.6e-05 0.0011 19.8 1.3 1 23 200 222 200 222 0.98 6 8 1.5e-06 0.0001 22.9 3.4 1 23 228 250 228 250 0.99 7 8 4.4e-05 0.0029 18.4 2.0 1 23 256 278 256 278 0.97 8 8 5.5e-06 0.00037 21.2 0.3 1 23 284 307 284 307 0.98
Sequence Information
- Coding Sequence
- ATGAGTGAAAGTAAAGGAAATTGGGTCGATCTCACGATTTTGGTGCCCTTATCCTTGTTCCTCCCTGTGGCGGAGAATCTTCTTCACGATGGAAAATGGACGTCCTATCTCAGCCACGTACGCATGAAACACCCTTCGGAATTCATCTGTGGTGTTTGTGGATACTCGTTCGTCAGTCGTCTTGGTCTCGCAATGCACCGTACTATGATGCACAAGGGAATAGAGGATAACCAAGAGAAGGAAGGAGAAGCGAAAGAGGATGATTCGAGGCCTTACTGCTCAGTGTGTGATGTCAAGTTTATCTCCGAAGAGGCTTACAAGCGACACATGGTCATGTCTACTAAACACATCCAGAACAATGAAGATAGCCACGGCTGTCGTTCGTGCGGCGAGCGGTTCCCGACCGCAGAAACCCTGCGCGCGCACCACCGCGCCGCGCacgcgcgcccgcgcccgcgcaaCTACGGCAAGCGGCCGCCGCCCTACTGCTGGCCCGCGCCGTGCACTTACTGCGGCGAGCAGGTGCCGAGCGGGCGCGCGTACTGGACGCACTTCCGGCGAGCGCACCCCGGACAGCCCTACCCCGTGCGCAAGGACCACGTGTGCGACGTCTGCGGGAAGAGCTTCCgggGCAACGCATTCTTAGTATACCACAAGCGCACGCACACGGACGAGCGAGCGTACCAGTGCTCGCTCTGCCCCAAGGCCTTCCACAACCGCACCAACCTGCAAATGCACCAGAAGACCCATTCTGATCACCGACCGCATCCTTGTACGGTCTGCTTCAAGGCTTTCAAGTCTAAAGGAGCATTGGACAGGCATTTCCGAAGCCACACAGGCGTAAAGCCGTACGAGTGTGAAGTGTGCGGCAAGGCGTTCAACCAGTCCAACAGTCGCAAGCTGCACGTGCGCACCGTGCATCTCCGGCAACCCGCGCCTTACGTCAGCCGGAACCGCGACAAACGGGCCAGGGCTGTGCCTAACCAGTTCTGA
- Protein Sequence
- MSESKGNWVDLTILVPLSLFLPVAENLLHDGKWTSYLSHVRMKHPSEFICGVCGYSFVSRLGLAMHRTMMHKGIEDNQEKEGEAKEDDSRPYCSVCDVKFISEEAYKRHMVMSTKHIQNNEDSHGCRSCGERFPTAETLRAHHRAAHARPRPRNYGKRPPPYCWPAPCTYCGEQVPSGRAYWTHFRRAHPGQPYPVRKDHVCDVCGKSFRGNAFLVYHKRTHTDERAYQCSLCPKAFHNRTNLQMHQKTHSDHRPHPCTVCFKAFKSKGALDRHFRSHTGVKPYECEVCGKAFNQSNSRKLHVRTVHLRQPAPYVSRNRDKRARAVPNQF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -